Entry information : SbPrx127 (Sobic.009G186600.1 [2.1] / SB09G024590 [1.4])
Entry ID 2736
Creation 2006-01-13 (Christophe Dunand)
Last sequence changes 2006-01-13 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx127 (Sobic.009G186600.1 [2.1] / SB09G024590 [1.4])
Name (synonym) SbPrx127 (Sobic.009G186600.1 [2.1] / SB09G024590 [1.4])
Class Class III peroxidase    [Orthogroup: Prx151]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx127
start..stop
S start..stop
ZmPrx102 618 0 23..347 21..340
SiPrx90 593 0 32..347 31..336
OsPrx75 512 0 36..347 37..349
BdiPrx70 485 6e-174 23..347 17..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 54127599..54127841 243 N° 2 54127941..54128129 189 N° 3 54128228..54128393 166 N° 4 54128562..54129007 446
join(54127599..54127841,54127941..54128129,54128228..54128393,54128562..54129007 )


exon

Literature and cross-references SbPrx127 (Sobic.009G186600.1 [2.1] / SB09G024590 [1.4])
Literature Plant Genome Database
DNA ref. Phytozome 12:   chromosome_9 (54127599..54129007)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.900.1
Protein sequence: SbPrx127 (Sobic.009G186600.1 [2.1] / SB09G024590 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   347 (319)
PWM (Da):   %s   37451.82 (34506.1) Transmb domain:   %s   i9-31o
PI (pH):   %s   5.64 (5.22) Peptide Signal:   %s   cut: 29 range:29-347
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWRERRPPPPLLLIVAGAALLVIGAALASAPPEAALKVGFYHETCPIAEDVVLAEMRLILMEDATVAPALLRMHYHDCFVQGCDGSIMLRSRKKGKAERDAVPNRSMRGYDAVERIKARVETVCPLTVSCADIIAMAARDAVYLSHGPWYDVETGRRDGNVTVAEYVENDLPPPDSNIVDVKTFFSVKSLNSKDIAVLFGCHSIGTSHCGAIQKRLYNFTGNMDQDPSLDPAYAAELRKLCPPPRPGGDDDGAGGEGKVKVPLDPGSNYTFDLSYYRHVLATGGLFQSDGSLLHDPVTKGYVEKVAKAASPDEYYADFAAAMVKMGRTDVLVGDLGEIRPTCGIFVD

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGAGGGAGCGGCGGCCGCCGCCGCCGCTGCTTCTGATAGTGGCCGGCGCGGCCCTGCTGGTGATCGGCGCGGCGCTCGCGAGCGCGCCGCCGGAGGCCGCGCTGAAGGTCGGGTTC
TACCATGAGACGTGCCCCATCGCGGAGGACGTTGTCCTCGCGGAGATGAGGCTCATCCTCATGGAGGACGCCACGGTGGCGCCGGCCCTGCTCCGGATGCACTACCACGACTGCTTCGTG
CAG
GTAAAGCATCAGCTGCTTCGTCCACGTACGTAGAGAAATGAACTCTTTCAGCGCGCGCTCTAGCTAGCTAGGCTCACGCACGCATGGCGTCCATGGAAGGGCTGCGACGGGTCGATC
ATGCTCCGGTCCAGGAAGAAGGGGAAGGCGGAGCGGGACGCGGTGCCCAACCGCAGCATGCGAGGGTACGACGCCGTCGAGCGGATCAAGGCCCGGGTCGAGACCGTCTGCCCGCTCACC
GTCTCCTGCGCCGACATCATCGCCATGGCCGCCAGGGACGCCGTCTACTTG
GTAAGCACTAAGCACACACATGCATGCAGCGTTAGATGCCAGTTTGTTCGATCGTGTGCTTAATTTGCT
GATCTCCTGATGAATGCCTGCCTGCCCAGAGCCACGGGCCGTGGTACGACGTGGAGACCGGGCGGCGCGACGGCAACGTCACCGTGGCCGAGTACGTCGAGAACGACCTGCCGCCGCCGG
ACTCCAACATCGTCGACGTCAAGACCTTCTTCAGCGTCAAGTCGCTCAACTCCAAGGACATCGCCGTCCTCTTCG
GTAGCTACCTAGCTAGCTTAGCTGCCCGCCCACTCCTCCTCCCTC
CTTTCTTCTCCACCACACGCACACCCTCCTAGCTAGCTAGCTTTTCGCGTGCGACAGCAACGCGTTAGCAAACCACTCCAACACTACCGCTAGCTTGCTAACGACCGCGTTGCCTGCCTT
CAGGGTGCCACAGCATCGGGACCTCCCACTGCGGGGCGATCCAGAAGCGGCTCTACAACTTCACCGGCAACATGGACCAGGACCCGTCGCTGGACCCGGCGTACGCCGCCGAGCTCCGGA
AGCTCTGCCCGCCGCCCCGCCCCGGCGGCGACGACGACGGTGCCGGCGGCGAAGGGAAGGTCAAGGTGCCTTTGGACCCCGGCAGCAACTACACCTTCGACCTGAGCTACTACCGCCACG
TGCTCGCCACGGGCGGGCTGTTCCAGTCCGACGGCAGCCTCCTGCACGACCCTGTCACCAAAGGGTACGTCGAGAAGGTGGCCAAGGCGGCGTCGCCGGACGAGTACTACGCGGACTTCG
CGGCGGCGATGGTCAAGATGGGCCGCACCGACGTGCTCGTCGGCGATCTTGGGGAGATCAGACCAACTTGTGGCATTTTTGTTGACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGAGGGAGCGGCGGCCGCCGCCGCCGCTGCTTCTGATAGTGGCCGGCGCGGCCCTGCTGGTGATCGGCGCGGCGCTCGCGAGCGCGCCGCCGGAGGCCGCGCTGAAGGTCGGGTTC
TACCATGAGACGTGCCCCATCGCGGAGGACGTTGTCCTCGCGGAGATGAGGCTCATCCTCATGGAGGACGCCACGGTGGCGCCGGCCCTGCTCCGGATGCACTACCACGACTGCTTCGTG
CAG
GGCTGCGACGGGTCGATCATGCTCCGGTCCAGGAAGAAGGGGAAGGCGGAGCGGGACGCGGTGCCCAACCGCAGCATGCGAGGGTACGACGCCGTCGAGCGGATCAAGGCCCGGGTC
GAGACCGTCTGCCCGCTCACCGTCTCCTGCGCCGACATCATCGCCATGGCCGCCAGGGACGCCGTCTACTTG
AGCCACGGGCCGTGGTACGACGTGGAGACCGGGCGGCGCGACGGCAAC
GTCACCGTGGCCGAGTACGTCGAGAACGACCTGCCGCCGCCGGACTCCAACATCGTCGACGTCAAGACCTTCTTCAGCGTCAAGTCGCTCAACTCCAAGGACATCGCCGTCCTCTTCG
GG
TGCCACAGCATCGGGACCTCCCACTGCGGGGCGATCCAGAAGCGGCTCTACAACTTCACCGGCAACATGGACCAGGACCCGTCGCTGGACCCGGCGTACGCCGCCGAGCTCCGGAAGCTC
TGCCCGCCGCCCCGCCCCGGCGGCGACGACGACGGTGCCGGCGGCGAAGGGAAGGTCAAGGTGCCTTTGGACCCCGGCAGCAACTACACCTTCGACCTGAGCTACTACCGCCACGTGCTC
GCCACGGGCGGGCTGTTCCAGTCCGACGGCAGCCTCCTGCACGACCCTGTCACCAAAGGGTACGTCGAGAAGGTGGCCAAGGCGGCGTCGCCGGACGAGTACTACGCGGACTTCGCGGCG
GCGATGGTCAAGATGGGCCGCACCGACGTGCTCGTCGGCGATCTTGGGGAGATCAGACCAACTTGTGGCATTTTTGTTGACTAG

Retrieve as FASTA