Entry information : SbPrx44 (Sobic.002G392300. [2.1] / Sb02g040770 [1.4])
Entry ID 2737
Creation 2008-10-15 (Christophe Dunand)
Last sequence changes 2008-10-15 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx44 (Sobic.002G392300. [2.1] / Sb02g040770 [1.4])
Name (synonym) SbPrx44 (Sobic.002G392300. [2.1] / Sb02g040770 [1.4])
Class Class III peroxidase    [Orthogroup: Prx143]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx44
start..stop
S start..stop
SiPrx176 504 0 48..349 46..350
SiPrx138 504 0 48..349 46..350
SiPrx140 489 2e-175 24..349 17..345
SiPrx141 489 5e-175 34..349 42..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 74672626..74672913 288 N° 2 74673044..74673805 762  
join(74672626..74672913,74673044..74673805)


exon

Literature and cross-references SbPrx44 (Sobic.002G392300. [2.1] / Sb02g040770 [1.4])
Literature Plant Genome Database
DNA ref. Phytozome 12:   chromosome_2 (74672626..74673805)
Protein sequence: SbPrx44 (Sobic.002G392300. [2.1] / Sb02g040770 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (322)
PWM (Da):   %s   36059.01 (33369.7)  
PI (pH):   %s   7.26 (6.73) Peptide Signal:   %s   cut: 28 range:28-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATTTRLAAALTSLAALLCSVMTSCHADGYGYYPSPTPTPTPTPTPSGAGLAVGFYSYSCPNAEAIVRGVVTKAVQQNPGVGAGLIRMLFHDCFVQGCDGSVLLDPTTANPQPEKLSPANFPSLRGFEVIDDAKSALEAACPGTVSCADVVAFAGRDASAVLSGGRANFAMPAGRRDGRVSLSSETLQFLPPPSFNLSQLAASFADKGLGVDDLVVLSGAHTVGRSHCSSFVRDGRLNASTSDMNPALAASLRQQCPANAATDNTVVQDVVTPDALDNQYYKNVMARNVLFTSDAALLQSSKTAASVALNAIVPGLWEQKFKVAMVKMASIGVKTGTNGEIRTNCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (chromo 2, intron 1). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACCACCACCAGGCTTGCTGCTGCTCTGACTTCACTTGCTGCGCTGCTGTGTTCGGTCATGACTTCCTGCCATGCTGACGGCTACGGTTACTACCCCAGCCCGACCCCGACGCCG
ACGCCGACGCCGACCCCGAGCGGCGCCGGCCTGGCCGTTGGCTTCTACAGCTACTCGTGCCCCAACGCCGAAGCCATCGTGAGGGGCGTCGTGACGAAGGCCGTGCAGCAGAACCCTGGC
GTCGGCGCAGGACTCATCCGAATGCTCTTCCACGACTGCTTCGTCCAG
GTATATATATGCATGCATTGTGTTCTTCAGCAAAGTGCTCTACATGCACCAGCAGGTCCAGCACCGTGCACG
TACGCGTCTGCCTTGTTGCCTGACCGTGTCGATCTGCAACGTTATCTTCGTCATTTAGGGTTGCGACGGCTCCGTGCTCCTCGACCCAACCACGGCGAACCCGCAGCCGGAGAAGCTATC
GCCGGCCAACTTCCCGAGCCTGCGTGGTTTCGAGGTCATCGACGACGCCAAGTCCGCGCTCGAGGCCGCGTGCCCGGGCACCGTCTCCTGCGCCGACGTCGTCGCCTTCGCCGGCCGCGA
CGCCAGCGCCGTCCTCAGCGGTGGCAGGGCCAACTTCGCGATGCCCGCGGGGCGCCGCGACGGCCGGGTGTCCCTGTCCAGCGAGACGCTCCAGTTCCTGCCACCTCCGTCCTTCAACCT
CTCCCAGCTCGCCGCCAGCTTCGCCGACAAGGGGCTCGGCGTCGACGACCTCGTCGTGCTCTCCGGCGCGCACACCGTCGGCCGCTCCCACTGCTCGTCCTTCGTCAGAGACGGCCGCCT
CAACGCGTCCACGTCCGACATGAACCCCGCGCTGGCCGCGTCGCTGCGGCAGCAGTGCCCGGCCAACGCCGCCACTGACAACACCGTGGTGCAGGACGTCGTGACGCCGGACGCGCTGGA
CAACCAGTACTACAAGAACGTGATGGCCCGGAACGTGCTCTTCACGTCGGACGCGGCGCTCCTCCAGTCCTCGAAGACCGCGGCGTCCGTGGCGCTCAACGCCATTGTGCCGGGGCTGTG
GGAGCAGAAGTTCAAGGTGGCCATGGTCAAGATGGCCAGCATCGGGGTGAAGACCGGCACCAACGGCGAGATCAGGACCAACTGCCGGGTCGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACCACCACCAGGCTTGCTGCTGCTCTGACTTCACTTGCTGCGCTGCTGTGTTCGGTCATGACTTCCTGCCATGCTGACGGCTACGGTTACTACCCCAGCCCGACCCCGACGCCG
ACGCCGACGCCGACCCCGAGCGGCGCCGGCCTGGCCGTTGGCTTCTACAGCTACTCGTGCCCCAACGCCGAAGCCATCGTGAGGGGCGTCGTGACGAAGGCCGTGCAGCAGAACCCTGGC
GTCGGCGCAGGACTCATCCGAATGCTCTTCCACGACTGCTTCGTCCAG
GGTTGCGACGGCTCCGTGCTCCTCGACCCAACCACGGCGAACCCGCAGCCGGAGAAGCTATCGCCGGCCAAC
TTCCCGAGCCTGCGTGGTTTCGAGGTCATCGACGACGCCAAGTCCGCGCTCGAGGCCGCGTGCCCGGGCACCGTCTCCTGCGCCGACGTCGTCGCCTTCGCCGGCCGCGACGCCAGCGCC
GTCCTCAGCGGTGGCAGGGCCAACTTCGCGATGCCCGCGGGGCGCCGCGACGGCCGGGTGTCCCTGTCCAGCGAGACGCTCCAGTTCCTGCCACCTCCGTCCTTCAACCTCTCCCAGCTC
GCCGCCAGCTTCGCCGACAAGGGGCTCGGCGTCGACGACCTCGTCGTGCTCTCCGGCGCGCACACCGTCGGCCGCTCCCACTGCTCGTCCTTCGTCAGAGACGGCCGCCTCAACGCGTCC
ACGTCCGACATGAACCCCGCGCTGGCCGCGTCGCTGCGGCAGCAGTGCCCGGCCAACGCCGCCACTGACAACACCGTGGTGCAGGACGTCGTGACGCCGGACGCGCTGGACAACCAGTAC
TACAAGAACGTGATGGCCCGGAACGTGCTCTTCACGTCGGACGCGGCGCTCCTCCAGTCCTCGAAGACCGCGGCGTCCGTGGCGCTCAACGCCATTGTGCCGGGGCTGTGGGAGCAGAAG
TTCAAGGTGGCCATGGTCAAGATGGCCAGCATCGGGGTGAAGACCGGCACCAACGGCGAGATCAGGACCAACTGCCGGGTCGTCAACTAG

Retrieve as FASTA