Entry information : SbPrx19 (Sobic.001G444400.1[2.1]SB01G041760[1.4])
Entry ID 2738
Creation 2006-01-13 (Christophe Dunand)
Last sequence changes 2006-01-13 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-01 (Messaoudi)
Peroxidase information: SbPrx19 (Sobic.001G444400.1[2.1]SB01G041760[1.4])
Name (synonym) SbPrx19 (Sobic.001G444400.1[2.1]SB01G041760[1.4])
Class Class III peroxidase    [Orthogroup: Prx023]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx19
start..stop
S start..stop
ZmPrx13 572 0 1..332 1..334
SiPrx153 551 0 1..332 1..332
BdiPrx45 511 0 8..332 9..334
OsPrx38 500 3e-180 30..332 33..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 65017563..65017793 231 N° 2 65017933..65018115 183 N° 3 65018237..65018402 166 N° 4 65018774..65019192 419
join(65017563..65017793,65017933..65018115,65018237..65018402,65018774..65019192 )


exon

Literature and cross-references SbPrx19 (Sobic.001G444400.1[2.1]SB01G041760[1.4])
Literature Plant Genome Database
DNA ref. Phytozome 12:   chromosome_1 (65017563..65019192)
Protein sequence: SbPrx19 (Sobic.001G444400.1[2.1]SB01G041760[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (302)
PWM (Da):   %s   34726.08 (31652.5) Transmb domain:   %s   i13-32o
PI (pH):   %s   5.65 (5.29) Peptide Signal:   %s   cut: 31 range:31-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MERNSSCRDTIMSCLLAVLAAAAVLAVARGQLTDDFYDGCCPHAEDIVKARVSAAMKAEPRMGASLLRLHFHDCFVNGCDGSILLDGNNTEKLAAPNLNSVRGFEVVDAIKADLEKACPGVVSCADILAIAAKYGVLLSGGPDYDVLLGRRDGLVANQSGANSNLPSPFDPINTITNKFNDVGLNTTDVVVLSGGHTIGRARCALFSNRLSNFSTTSSVDPTLNSSLASSLQTLCQGGDGNQTAALDAGSADTFDNHYYQNLLTQRGLLSSDQGLFSSTDDGAAATKALVQAYSANSQRFFCDFGRSMVKMGNISPLTGSAGQIRKNCRAVN

Retrieve as FASTA  
Remarks Complete sequence from Genomic (chromo 1, 3 introns). No EST. Two peroxidases encoding sequence in the same contig (SbPrx108).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCGCAACTCCTCCTGCAGAGACACAATAATGAGCTGCCTCCTCGCCGTGCTCGCCGCCGCCGCGGTGCTCGCGGTGGCGCGGGGCCAGCTGACGGACGACTTCTACGACGGGTGC
TGCCCCCATGCGGAGGACATCGTGAAGGCGCGCGTGTCCGCCGCGATGAAGGCCGAGCCCCGCATGGGCGCCTCCCTGCTCAGGCTCCACTTCCACGACTGCTTCGTCAAC
GTACGTAGT
ACGAGACACCGCGCTCGTGACACATATATATACACGCACGCTCCCAATGCAATGCAACTTTTATGTACCGATCGATAGCTGAATTGAAAAAAGACTTTGCTCGCTGCATGCATGCACGCA
ACTAACGCAGGGGTGCGACGGCTCGATCCTGCTGGACGGGAATAACACCGAGAAGCTGGCGGCGCCGAACCTGAACTCGGTGCGTGGGTTCGAGGTCGTCGACGCCATCAAGGCCGACCT
CGAGAAGGCGTGCCCCGGGGTTGTCTCCTGCGCCGATATCCTCGCGATCGCCGCTAAATACGGAGTGCTGCTG
GTGCTGCGTCCCGTCCCTTTCCCTTCCCTTCCCTCTCTCCCACATGA
CTTCAGTCATCGGTTCATCATCATCATCACACGCTGAAAAATACTCGCAATGTACCTGCTGGTGTATTATTCAGAGTGGAGGGCCAGACTACGACGTTCTGCTGGGAAGGAGGGATGGCC
TGGTGGCAAATCAGTCCGGTGCCAACAGTAACCTGCCTAGCCCGTTCGATCCCATCAACACCATCACAAATAAGTTCAATGATGTGGGTCTGAATACAACCGACGTGGTCGTTTTATCAG
GTATAACTGCTAGTCCCACTCATCATCTTTCACTGCACACACAATACTTTCCCAGCTGGACTGATTTAGGGAGTCAAGAGTAGTGATGGTGATGAATGGACGTTTACTATTACGTACTAG
TATATTGCCCGTGCTAACGCTACGGTAGCATTTAGAGCCGCACCCGTGGTGAATTTGTGTGATGTGTGATTGACACGAGTCTAAAGGTGTGTAAGGTCGTGATCATACTTCTAATCTGGG
CCGTTAAATCTGTAGGATATGTACTATGAGTCATTGATCTTGCAGGTGGAATTTGCCTAGATAAGATTTCAATTATAATAGAGAAGAGATATTACATTTACTGACCCGATCGACGGCAAC
TGGACGCGCAGGAGGCCACACGATCGGGCGAGCGCGGTGCGCGCTGTTCAGCAACCGGCTATCCAACTTCTCGACGACGAGCTCCGTGGACCCGACGCTGAACTCGTCGCTGGCGTCCAG
CCTGCAGACGCTGTGCCAGGGCGGGGACGGCAACCAGACGGCGGCGCTGGACGCCGGCTCCGCCGACACGTTCGACAACCACTACTACCAGAACCTGCTGACCCAGAGGGGCCTGCTGTC
CTCCGACCAAGGCCTCTTCTCCAGCACCGACGACGGCGCGGCGGCCACGAAGGCGCTCGTGCAGGCATACAGCGCCAACAGCCAGCGCTTCTTCTGCGACTTCGGCCGGTCCATGGTCAA
GATGGGCAACATCAGCCCGCTCACCGGCTCCGCCGGCCAGATCCGTAAGAACTGCCGTGCCGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGCGCAACTCCTCCTGCAGAGACACAATAATGAGCTGCCTCCTCGCCGTGCTCGCCGCCGCCGCGGTGCTCGCGGTGGCGCGGGGCCAGCTGACGGACGACTTCTACGACGGGTGC
TGCCCCCATGCGGAGGACATCGTGAAGGCGCGCGTGTCCGCCGCGATGAAGGCCGAGCCCCGCATGGGCGCCTCCCTGCTCAGGCTCCACTTCCACGACTGCTTCGTCAAC
GGGTGCGAC
GGCTCGATCCTGCTGGACGGGAATAACACCGAGAAGCTGGCGGCGCCGAACCTGAACTCGGTGCGTGGGTTCGAGGTCGTCGACGCCATCAAGGCCGACCTCGAGAAGGCGTGCCCCGGG
GTTGTCTCCTGCGCCGATATCCTCGCGATCGCCGCTAAATACGGAGTGCTGCTG
AGTGGAGGGCCAGACTACGACGTTCTGCTGGGAAGGAGGGATGGCCTGGTGGCAAATCAGTCCGGT
GCCAACAGTAACCTGCCTAGCCCGTTCGATCCCATCAACACCATCACAAATAAGTTCAATGATGTGGGTCTGAATACAACCGACGTGGTCGTTTTATCAG
GAGGCCACACGATCGGGCGA
GCGCGGTGCGCGCTGTTCAGCAACCGGCTATCCAACTTCTCGACGACGAGCTCCGTGGACCCGACGCTGAACTCGTCGCTGGCGTCCAGCCTGCAGACGCTGTGCCAGGGCGGGGACGGC
AACCAGACGGCGGCGCTGGACGCCGGCTCCGCCGACACGTTCGACAACCACTACTACCAGAACCTGCTGACCCAGAGGGGCCTGCTGTCCTCCGACCAAGGCCTCTTCTCCAGCACCGAC
GACGGCGCGGCGGCCACGAAGGCGCTCGTGCAGGCATACAGCGCCAACAGCCAGCGCTTCTTCTGCGACTTCGGCCGGTCCATGGTCAAGATGGGCAACATCAGCCCGCTCACCGGCTCC
GCCGGCCAGATCCGTAAGAACTGCCGTGCCGTCAACTGA

Retrieve as FASTA