Entry information : SbPrx106 (Sobic.008G066700.1 [2.1] / Sb08g005520 [1.4])
Entry ID 2743
Creation 2008-11-16 (Christophe Dunand)
Last sequence changes 2011-01-21 (Toky Ramarohetra)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx106 (Sobic.008G066700.1 [2.1] / Sb08g005520 [1.4])
Name (synonym) SbPrx106 (Sobic.008G066700.1 [2.1] / Sb08g005520 [1.4])
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx106
start..stop
S start..stop
ZmPrx130 574 0 24..341 18..334
SiPrx53 562 0 31..341 22..331
OsPrx137 534 0 16..341 5..327
ZmPrx131 530 0 31..341 27..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7584114..7584362 249 N° 2 7583789..7583974 186 N° 3 7583526..7583688 163 N° 4 7583008..7583435 428
complement(join(7583008..7583435,7583526..7583688,7583789..7583974,7584114..7584 362))


exon

Literature and cross-references SbPrx106 (Sobic.008G066700.1 [2.1] / Sb08g005520 [1.4])
Literature JGI
DNA ref. Phytozome 11:   chromosome_8 (7584362..7583008)
Protein sequence: SbPrx106 (Sobic.008G066700.1 [2.1] / Sb08g005520 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (305)
PWM (Da):   %s   34858.33 (31664.6) Transmb domain:   %s   i13-35o
PI (pH):   %s   4.3 (4.21) Peptide Signal:   %s   cut: 37 range:37-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASRGAVVSSRAGGAAAAAAAFLLLLLVGVGVGSAQLQVGFYSDSCPDAEDTVTAAVQDAAGNDPTILPALLRLQFHDCFVKGCDASVLIRSATNDAEVDNAKNQGLRGQDVVDAAKAQLEDQCPGVVSCADILALAARDAVAMTGGPSFDVPTGRRDGLTSNLRDADVLPDAGDSISVLRSRFAASGLDDRDLVLLTAAHTVGTTACFFVKDRLYSYPLPGGGTGADPSIPAPFVAELKARCPPGDFNTRLPLDRGSETDFDDSILRNIRSGFAVIASDAALANSNATRALVDAYLGASARSFQRDFAAAMVKMGTVGAITGDDDAGEVRDVCSAFNSN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 3 introns). No EST
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCCAGCCGCGGTGCCGTGGTGTCGTCTAGAGCCGGTGGGGCGGCGGCGGCGGCGGCGGCGTTCTTGCTGTTGTTGCTTGTTGGAGTTGGAGTTGGCAGTGCCCAGCTCCAGGTG
GGGTTCTACTCCGACTCCTGCCCGGACGCCGAGGACACGGTCACCGCCGCCGTCCAGGACGCCGCCGGCAACGACCCCACCATCCTCCCCGCGCTCCTCCGCCTCCAGTTCCACGACTGC
TTCGTCAAG
GTGTACGATCGACACGACGTGTGTGTGTTTGTCCAGCAAGTCCGCCGGCCGATTAATTAACACTAGCTTTATTTTACGTGTCTGTCTGTGTGTGTGTGTGCGTGCTCGCCG
GCCGGCGTCCGGCGATATATATATGCAGGGGTGCGACGCGTCGGTGCTGATCCGGAGCGCGACCAACGACGCCGAGGTGGACAACGCCAAGAACCAGGGCCTCCGCGGCCAGGATGTGGT
GGACGCCGCCAAGGCGCAGCTCGAGGACCAGTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCGCTCGCCGCGCGCGACGCCGTCGCCATG
GTAACATGCAATTCAACTGGATATAG
GTAGATGATGGTCGTAGAGTAGTCGTCGTAGCTGACGCGCTGGGAATTGGAATAAATGCCAACCAACCAACCAGACGGGCGGGCCGTCGTTCGACGTGCCCACGGGGCGGCGCGACGGGC
TGACCTCCAACCTCCGCGACGCCGACGTGCTTCCCGACGCCGGCGACTCCATCAGCGTGCTCCGATCACGGTTCGCCGCCAGCGGCCTCGACGACCGCGACCTCGTCCTCCTCACAG
GTG
TGTATACCTTCACACTTCACGTGCATGGACATGGACGCCGGCACGCCGCCGGCCTACCACTGACACTTGAAACGAGACCGGCCGCAGCGGCGCACACGGTGGGCACGACGGCGTGCTTCT
TCGTGAAGGACCGGCTGTACAGCTACCCGCTGCCGGGCGGCGGGACGGGCGCCGACCCGTCGATCCCGGCGCCGTTCGTGGCGGAGCTCAAGGCCCGGTGCCCGCCGGGGGATTTCAACA
CGCGCCTGCCGCTGGACCGCGGCAGCGAGACCGACTTCGACGACTCCATCCTCCGGAACATCCGCTCCGGCTTCGCCGTCATCGCCTCCGACGCCGCGCTCGCCAACAGCAACGCCACCC
GCGCGCTCGTCGACGCGTACCTGGGCGCCTCGGCGCGCAGCTTCCAGCGGGACTTCGCCGCCGCCATGGTCAAGATGGGCACCGTCGGCGCCATTACCGGCGACGACGACGCCGGCGAGG
TCAGGGACGTCTGCTCTGCGTTCAACAGCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCCAGCCGCGGTGCCGTGGTGTCGTCTAGAGCCGGTGGGGCGGCGGCGGCGGCGGCGGCGTTCTTGCTGTTGTTGCTTGTTGGAGTTGGAGTTGGCAGTGCCCAGCTCCAGGTG
GGGTTCTACTCCGACTCCTGCCCGGACGCCGAGGACACGGTCACCGCCGCCGTCCAGGACGCCGCCGGCAACGACCCCACCATCCTCCCCGCGCTCCTCCGCCTCCAGTTCCACGACTGC
TTCGTCAAG
GGGTGCGACGCGTCGGTGCTGATCCGGAGCGCGACCAACGACGCCGAGGTGGACAACGCCAAGAACCAGGGCCTCCGCGGCCAGGATGTGGTGGACGCCGCCAAGGCGCAG
CTCGAGGACCAGTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCGCTCGCCGCGCGCGACGCCGTCGCCATG
ACGGGCGGGCCGTCGTTCGACGTGCCCACGGGGCGGCGCGACGGG
CTGACCTCCAACCTCCGCGACGCCGACGTGCTTCCCGACGCCGGCGACTCCATCAGCGTGCTCCGATCACGGTTCGCCGCCAGCGGCCTCGACGACCGCGACCTCGTCCTCCTCACAG
CG
GCGCACACGGTGGGCACGACGGCGTGCTTCTTCGTGAAGGACCGGCTGTACAGCTACCCGCTGCCGGGCGGCGGGACGGGCGCCGACCCGTCGATCCCGGCGCCGTTCGTGGCGGAGCTC
AAGGCCCGGTGCCCGCCGGGGGATTTCAACACGCGCCTGCCGCTGGACCGCGGCAGCGAGACCGACTTCGACGACTCCATCCTCCGGAACATCCGCTCCGGCTTCGCCGTCATCGCCTCC
GACGCCGCGCTCGCCAACAGCAACGCCACCCGCGCGCTCGTCGACGCGTACCTGGGCGCCTCGGCGCGCAGCTTCCAGCGGGACTTCGCCGCCGCCATGGTCAAGATGGGCACCGTCGGC
GCCATTACCGGCGACGACGACGCCGGCGAGGTCAGGGACGTCTGCTCTGCGTTCAACAGCAATTGA

Retrieve as FASTA