Entry information : SbPrx74 (Sobic.004G105700.1 [2.1] / SB04G008620 [1.4])
Entry ID 2745
Creation 2008-11-17 (Christophe Dunand)
Last sequence changes 2008-11-17 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx74 (Sobic.004G105700.1 [2.1] / SB04G008620 [1.4])
Name (synonym) SbPrx74 (Sobic.004G105700.1 [2.1] / SB04G008620 [1.4])
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx74
start..stop
S start..stop
ZmPrx123 556 0 1..326 1..324
SiPrx77 553 0 2..325 3..320
HvPrx13 506 0 2..325 5..322
BdiPrx99 496 4e-179 1..325 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10056387..10056608 222 N° 2 10056750..10056941 192 N° 3 10057015..10057581 567  
join(10056387..10056608,10056750..10056941,10057015..10057581)


exon

Literature and cross-references SbPrx74 (Sobic.004G105700.1 [2.1] / SB04G008620 [1.4])
Literature Plant Genome Database.
DNA ref. Phytozome 11:   chromosome_4 (10056387..10057581)
Protein sequence: SbPrx74 (Sobic.004G105700.1 [2.1] / SB04G008620 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (299)
PWM (Da):   %s   34176.28 (31235.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.36 (6.88) Peptide Signal:   %s   cut: 28 range:28-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASFRTWHCLLATSCLFLLLLASPAHGQLSPSFYATSCPTLGLIVRTTMIKALLAERRMGASLVRLFFHDCFVQGCDGSILLDDVGSFVGEKGAGPNVNSVRGFDVIDQIKTNVELICPGVVSCADIVALAARFGTFLLGGPSWAVPLGRRDSTTASLTLANSDLPSPASGLATLVTAFGNKGLSPGDLTALSGAHTIGFSQCQNFRGHIYNDTDIDAAFAALRQRSCPAAPGTGGDTNLAALDVQTQLVFDNAYYRNLLAKRGLLHSDQELFNGGSQDALVRQYSSNPALFASDFAAAMIKMGNISPLTGTAGQIRANCRVVNSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, intron 1 and 2). No ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGTTCCGGACGTGGCACTGCTTGCTCGCCACCAGCTGCTTGTTCCTCCTGCTGCTCGCTTCGCCGGCGCACGGGCAGCTCTCGCCGTCCTTCTACGCGACGAGCTGCCCGACG
CTGGGGCTCATCGTTCGGACCACCATGATCAAGGCTCTCCTCGCCGAGCGTCGGATGGGCGCGTCCCTCGTCAGGCTCTTCTTCCACGACTGCTTTGTTCAA
GTACGTACGGGCCGTTTC
ATATGTATTGTACTACTGAGTACTCTGTATATAACGTAAGATTTGATGTAACAGAGAATCTAAAACAAATTATAAAATTTCTTATTATAGAAACTAAACAAGGCCTTAATTTGTTACCTG
CAGGGCTGCGACGGCTCCATTCTTCTGGACGACGTCGGCAGCTTCGTCGGCGAGAAGGGCGCCGGCCCCAACGTCAACTCCGTCCGCGGCTTCGACGTCATCGACCAGATCAAGACCAAC
GTCGAGCTCATCTGCCCCGGCGTTGTCTCCTGCGCCGACATCGTCGCCCTCGCCGCACGATTCGGCACCTTCTTG
GTACACTCGTCGTGACGTCTCGTACTACATGTCTCTTGGTAGTTA
GTACATCAGTTCTGCATCATATTCACAGCTGGGAGGACCAAGTTGGGCGGTGCCGCTCGGCCGGCGCGACTCGACGACGGCGAGCCTGACGCTAGCCAACAGCGACCTCCCGTCGCCGGC
CTCTGGCCTCGCCACCCTCGTCACGGCATTCGGCAACAAGGGCCTGAGCCCGGGGGACCTGACGGCGCTGTCCGGCGCGCACACCATCGGCTTCTCGCAGTGCCAGAACTTCCGCGGCCA
CATCTACAACGACACCGACATCGACGCGGCGTTCGCCGCCCTGCGCCAGCGCAGCTGCCCCGCGGCGCCGGGCACCGGCGGCGACACCAACCTGGCGGCGCTCGACGTGCAGACGCAGCT
CGTCTTCGACAACGCCTACTACCGCAACCTGCTGGCCAAACGCGGCCTGCTGCACTCCGACCAGGAGCTCTTCAACGGCGGCTCCCAGGACGCGCTGGTGCGGCAGTACAGCTCCAACCC
GGCACTCTTCGCCTCAGACTTCGCCGCCGCCATGATAAAGATGGGCAACATCAGCCCGCTCACCGGAACCGCTGGCCAGATCAGGGCAAACTGTAGGGTGGTCAACAGCAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGTTCCGGACGTGGCACTGCTTGCTCGCCACCAGCTGCTTGTTCCTCCTGCTGCTCGCTTCGCCGGCGCACGGGCAGCTCTCGCCGTCCTTCTACGCGACGAGCTGCCCGACG
CTGGGGCTCATCGTTCGGACCACCATGATCAAGGCTCTCCTCGCCGAGCGTCGGATGGGCGCGTCCCTCGTCAGGCTCTTCTTCCACGACTGCTTTGTTCAA
GGCTGCGACGGCTCCATT
CTTCTGGACGACGTCGGCAGCTTCGTCGGCGAGAAGGGCGCCGGCCCCAACGTCAACTCCGTCCGCGGCTTCGACGTCATCGACCAGATCAAGACCAACGTCGAGCTCATCTGCCCCGGC
GTTGTCTCCTGCGCCGACATCGTCGCCCTCGCCGCACGATTCGGCACCTTCTTG
CTGGGAGGACCAAGTTGGGCGGTGCCGCTCGGCCGGCGCGACTCGACGACGGCGAGCCTGACGCTA
GCCAACAGCGACCTCCCGTCGCCGGCCTCTGGCCTCGCCACCCTCGTCACGGCATTCGGCAACAAGGGCCTGAGCCCGGGGGACCTGACGGCGCTGTCCGGCGCGCACACCATCGGCTTC
TCGCAGTGCCAGAACTTCCGCGGCCACATCTACAACGACACCGACATCGACGCGGCGTTCGCCGCCCTGCGCCAGCGCAGCTGCCCCGCGGCGCCGGGCACCGGCGGCGACACCAACCTG
GCGGCGCTCGACGTGCAGACGCAGCTCGTCTTCGACAACGCCTACTACCGCAACCTGCTGGCCAAACGCGGCCTGCTGCACTCCGACCAGGAGCTCTTCAACGGCGGCTCCCAGGACGCG
CTGGTGCGGCAGTACAGCTCCAACCCGGCACTCTTCGCCTCAGACTTCGCCGCCGCCATGATAAAGATGGGCAACATCAGCCCGCTCACCGGAACCGCTGGCCAGATCAGGGCAAACTGT
AGGGTGGTCAACAGCAGCTGA

Retrieve as FASTA