Entry information : SbPrx120 (Sobic.009G144700.1 [2.1] / SB09G020970 [1.4])
Entry ID 2747
Creation 2006-01-16 (Christophe Dunand)
Last sequence changes 2006-01-16 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx120 (Sobic.009G144700.1 [2.1] / SB09G020970 [1.4])
Name (synonym) SbPrx120 (Sobic.009G144700.1 [2.1] / SB09G020970 [1.4])
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx120
start..stop
S start..stop
SbPrx119 565 0 1..320 1..322
SbPrx124 524 0 1..317 1..319
SbPrx122 514 0 35..320 41..326
SbPrx123 511 0 1..319 1..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50409685..50409936 252 N° 2 50410039..50410233 195 N° 3 50410351..50410513 163 N° 4 50410629..50410981 353
join(50409685..50409936,50410039..50410233,50410351..50410513,50410629..50410981 )


exon

Literature and cross-references SbPrx120 (Sobic.009G144700.1 [2.1] / SB09G020970 [1.4])
Literature Plant Genome Database
DNA ref. Phytozome 12:   chromosome_9 (50409685..50410981)
Protein sequence: SbPrx120 (Sobic.009G144700.1 [2.1] / SB09G020970 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (290)
PWM (Da):   %s   34277.2 (31573.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.96 (6.98) Peptide Signal:   %s   cut: 31 range:31-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSCFSSPASALAAVCVLLLALAGAAVGHRPSGGSALSSAFYDASCPSAYDVVRRVIQDARVSDARIPASLIRLHFHDCFVNGCDGSLLLDDDLQAIQTEKRVPANNNSARGFPVVDDIKSALEEACPGIVSCADILALAAEISVELAGGPRWRVLLGRRDATTTNVQSARNLPNFFDPLSVLQEKFRNLNLDDTDLVALQGAHTFGKVQCQFTQQNCTAGQSRGALENLDQVTPKVFDNKYYSNLLQGRAQLPSDQVMLSDPSAATTTAPIVHRFASNQQDFFRNFAASMIKMGNISPLTGKDGEIRNNCRRVNKHY

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTTCCTCCTGCTTCTCGTCTCCGGCCTCGGCGTTAGCGGCGGTCTGCGTGCTCTTGCTCGCCCTAGCTGGAGCCGCGGTCGGTCACCGTCCCAGCGGCGGCTCGGCGCTGAGC
TCCGCGTTCTACGACGCGTCGTGCCCCAGCGCCTACGACGTCGTCCGGCGCGTCATCCAGGACGCTCGCGTCTCCGACGCTCGCATCCCGGCCAGCCTCATCCGCCTCCATTTCCACGAC
TGCTTCGTTAAC
GTACGCGCGAACAGCTGCGCTGATTTGTATCTCCTCTGAATTCTGACATATATTGCATCATCTGACACGAACGTCCGTCCGTACTACGCTGATCTGTTTCAGGGTTGC
GACGGCTCGCTCCTGCTGGACGACGACCTCCAGGCGATCCAGACCGAGAAGCGTGTGCCCGCCAACAACAACTCGGCGCGTGGCTTTCCGGTGGTCGACGACATCAAGAGCGCGCTGGAG
GAAGCGTGCCCCGGCATCGTCTCCTGCGCCGACATCCTCGCCCTGGCAGCCGAGATCTCCGTCGAACTC
GTAAGCACTCGAGAAGAGAACTCACTCTTTCATCAACCGGCGCGGCTACCT
CTATGTATCACACCCACTCTGATGCTGTGAACTGACGGAACGAACCATGCATGGATCGGTGTGCAGGCTGGAGGACCACGGTGGAGGGTGCTTCTTGGCCGGCGAGACGCCACGACGACC
AACGTCCAGAGCGCCAGGAACCTACCCAACTTCTTCGACCCCCTAAGCGTCCTCCAGGAGAAGTTTAGAAACCTTAACCTCGACGACACTGACCTCGTCGCCCTCCAAG
GTAATCAATCT
ACATCTACTTATCGATGTAGCAACACAAACAGTTCAAGCCTTAGAAAGCTCAGCATGTGCCTTGTCACAAATCTGAACATATTTGTTATTTCTACTCCATTCAGGAGCGCACACATTTGG
CAAAGTACAGTGCCAGTTCACGCAGCAGAATTGCACTGCTGGCCAGTCCCGCGGCGCACTGGAGAACTTGGACCAGGTCACACCCAAGGTGTTCGACAACAAATATTACAGCAACCTTTT
ACAAGGCCGCGCTCAGCTCCCGTCCGACCAGGTTATGCTATCGGACCCTTCTGCAGCGACAACCACTGCTCCCATTGTTCATCGGTTCGCAAGCAACCAACAGGACTTCTTCAGAAACTT
CGCGGCATCCATGATTAAGATGGGAAACATTAGCCCGCTGACAGGAAAGGATGGGGAGATCAGGAACAATTGCCGGAGGGTTAACAAACACTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTTCCTCCTGCTTCTCGTCTCCGGCCTCGGCGTTAGCGGCGGTCTGCGTGCTCTTGCTCGCCCTAGCTGGAGCCGCGGTCGGTCACCGTCCCAGCGGCGGCTCGGCGCTGAGC
TCCGCGTTCTACGACGCGTCGTGCCCCAGCGCCTACGACGTCGTCCGGCGCGTCATCCAGGACGCTCGCGTCTCCGACGCTCGCATCCCGGCCAGCCTCATCCGCCTCCATTTCCACGAC
TGCTTCGTTAAC
GGTTGCGACGGCTCGCTCCTGCTGGACGACGACCTCCAGGCGATCCAGACCGAGAAGCGTGTGCCCGCCAACAACAACTCGGCGCGTGGCTTTCCGGTGGTCGACGAC
ATCAAGAGCGCGCTGGAGGAAGCGTGCCCCGGCATCGTCTCCTGCGCCGACATCCTCGCCCTGGCAGCCGAGATCTCCGTCGAACTC
GCTGGAGGACCACGGTGGAGGGTGCTTCTTGGC
CGGCGAGACGCCACGACGACCAACGTCCAGAGCGCCAGGAACCTACCCAACTTCTTCGACCCCCTAAGCGTCCTCCAGGAGAAGTTTAGAAACCTTAACCTCGACGACACTGACCTCGTC
GCCCTCCAAG
GAGCGCACACATTTGGCAAAGTACAGTGCCAGTTCACGCAGCAGAATTGCACTGCTGGCCAGTCCCGCGGCGCACTGGAGAACTTGGACCAGGTCACACCCAAGGTGTTC
GACAACAAATATTACAGCAACCTTTTACAAGGCCGCGCTCAGCTCCCGTCCGACCAGGTTATGCTATCGGACCCTTCTGCAGCGACAACCACTGCTCCCATTGTTCATCGGTTCGCAAGC
AACCAACAGGACTTCTTCAGAAACTTCGCGGCATCCATGATTAAGATGGGAAACATTAGCCCGCTGACAGGAAAGGATGGGGAGATCAGGAACAATTGCCGGAGGGTTAACAAACACTAC
TGA

Retrieve as FASTA