Entry information : SbPrx119 (Sobic.009G144600.1 [2.1] / SB09G020960 [1.4])
Entry ID 2751
Creation 2010-01-22 (Christophe Dunand)
Last sequence changes 2010-01-22 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx119 (Sobic.009G144600.1 [2.1] / SB09G020960 [1.4])
Name (synonym) SbPrx119 (Sobic.009G144600.1 [2.1] / SB09G020960 [1.4])
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx119
start..stop
S start..stop
SbPrx120 581 0 1..322 1..320
SbPrx122 516 0 31..322 34..326
SiPrx101 509 0 1..321 1..315
SbPrx124 509 0 1..321 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50404738..50404995 258 N° 2 50405098..50405292 195 N° 3 50405411..50405573 163 N° 4 50405698..50406050 353
join(50404738..50404995,50405098..50405292,50405411..50405573,50405698..50406050 )


exon

Literature and cross-references SbPrx119 (Sobic.009G144600.1 [2.1] / SB09G020960 [1.4])
Literature Bedell,J.A., Budiman,M.A., Nunberg,A., Citek,R.W., Robbins,D., Jones,J., Flick,E., Rohlfing,T., Fries,J., Bradford,K., McMenamy,J. , Smith,M., Holeman,H., Roe,B.A, Wiley,G., Korf,I.F., Rabinowicz ,P.D., Lakey,N., McCombie,W.R., Jeddeloh,J.A. and Martienssen,R.A. Sorghum genome sequencing by methylation filtration. PLoS Biol. 3 (1), e13 (2005).
DNA ref. Phytozome 12:   chromosome_9 (50404738..50406050)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.8618.1
Protein sequence: SbPrx119 (Sobic.009G144600.1 [2.1] / SB09G020960 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (292)
PWM (Da):   %s   34362.09 (31544.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.49 (6.50) Peptide Signal:   %s   cut: 31 range:31-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSCFSSPATAFAACCMLLLALSGAALGHRPSGGGGSALSSTFYDATCPSAYDVVRRVIQDARVSDARIPASLIRLHFHDCFVTGCDGSLLLDDDLPAIQTEKRVPANNNSARGFPVVDDIKSALEEACPGIVSCADILALAAEISVELAGGPRWSVLLGRRDGTTTNVQSARNLPNFFDPLSVLQEKFRNVNLDDTDLVALQGAHTFGKVQCQFTQQNCTAGQSRGALENLDQVTPKVFDNKYYSNLLQGHAQLPSDQVMLSDPSAAATTAPIVHRFAGNQQEFFRNFAASMIKMGNISPLTGKDGEIRNNCRRVNKRY

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTTCCTCCTGCTTCTCGTCCCCCGCCACGGCGTTTGCGGCGTGCTGCATGCTCTTGCTCGCCCTATCTGGAGCCGCGCTCGGTCACCGTCCCAGCGGCGGCGGCGGCTCGGCG
CTGAGCTCCACGTTCTACGACGCGACCTGCCCCAGCGCCTACGACGTCGTCCGGCGCGTCATCCAGGACGCGCGCGTCTCCGACGCTCGCATCCCGGCCAGCCTCATCCGCCTCCATTTC
CACGACTGTTTCGTCACC
GTGAGCACCGGCGTTATATTAGTCATTGTCCATGACTCTTCCACGTACTACACGCATTGCTTCCATCTGACAATACACGCTTAATTATTTCTTTCATTTCAG

GGTTGCGACGGCTCGCTCCTGCTGGACGACGACCTCCCGGCGATCCAGACCGAGAAGCGTGTGCCCGCCAACAACAACTCGGCGCGTGGCTTTCCGGTGGTCGACGACATCAAGAGCGCG
CTGGAGGAAGCGTGCCCCGGCATCGTCTCCTGCGCCGACATCCTCGCCCTTGCAGCTGAGATCTCCGTCGAACTC
GTATGCACTCGAGACCTCACTAGATCTTTCATCAACCCGCGCCGA
CTCTACCTATCACGCTCACGCCTGATGATGTGAACTGACGGAAGGAACCATGCATGGATCGCTATATATGCAGGCTGGAGGACCACGGTGGAGCGTGCTTCTTGGCCGGCGAGACGGCAC
GACGACCAACGTCCAGAGCGCCAGGAACCTGCCCAACTTCTTCGACCCCCTGAGCGTCCTCCAGGAGAAGTTTAGAAACGTCAACCTCGACGACACTGACCTCGTCGCCCTCCAAG
GTAA
TCAATCTACATCTACTTAGTAACTTAGCGACGTAGGAGTAGCAAAACAAACAGTTCAAGCTTAGAAAGCTCAGCGTGTGCCTTGTCACAAATCTCAACATATTTGCTATTTCTACTTCAG

GAGCGCACACATTCGGCAAAGTGCAGTGCCAATTCACGCAGCAGAATTGCACGGCCGGGCAGTCTAGAGGCGCATTGGAGAACTTGGACCAGGTCACACCCAAGGTGTTCGACAACAAGT
ATTACAGCAACCTCTTACAGGGCCACGCTCAGCTCCCGTCCGACCAGGTTATGCTGTCGGACCCTTCTGCGGCTGCGACCACGGCTCCCATTGTTCATCGGTTCGCAGGCAACCAACAGG
AGTTTTTCAGAAACTTCGCAGCATCCATGATTAAGATGGGAAACATTAGCCCACTGACAGGGAAGGATGGGGAGATCAGGAACAACTGCCGGAGGGTTAACAAACGCTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTTCCTCCTGCTTCTCGTCCCCCGCCACGGCGTTTGCGGCGTGCTGCATGCTCTTGCTCGCCCTATCTGGAGCCGCGCTCGGTCACCGTCCCAGCGGCGGCGGCGGCTCGGCG
CTGAGCTCCACGTTCTACGACGCGACCTGCCCCAGCGCCTACGACGTCGTCCGGCGCGTCATCCAGGACGCGCGCGTCTCCGACGCTCGCATCCCGGCCAGCCTCATCCGCCTCCATTTC
CACGACTGTTTCGTCACC
GGTTGCGACGGCTCGCTCCTGCTGGACGACGACCTCCCGGCGATCCAGACCGAGAAGCGTGTGCCCGCCAACAACAACTCGGCGCGTGGCTTTCCGGTGGTC
GACGACATCAAGAGCGCGCTGGAGGAAGCGTGCCCCGGCATCGTCTCCTGCGCCGACATCCTCGCCCTTGCAGCTGAGATCTCCGTCGAACTC
GCTGGAGGACCACGGTGGAGCGTGCTT
CTTGGCCGGCGAGACGGCACGACGACCAACGTCCAGAGCGCCAGGAACCTGCCCAACTTCTTCGACCCCCTGAGCGTCCTCCAGGAGAAGTTTAGAAACGTCAACCTCGACGACACTGAC
CTCGTCGCCCTCCAAG
GAGCGCACACATTCGGCAAAGTGCAGTGCCAATTCACGCAGCAGAATTGCACGGCCGGGCAGTCTAGAGGCGCATTGGAGAACTTGGACCAGGTCACACCCAAG
GTGTTCGACAACAAGTATTACAGCAACCTCTTACAGGGCCACGCTCAGCTCCCGTCCGACCAGGTTATGCTGTCGGACCCTTCTGCGGCTGCGACCACGGCTCCCATTGTTCATCGGTTC
GCAGGCAACCAACAGGAGTTTTTCAGAAACTTCGCAGCATCCATGATTAAGATGGGAAACATTAGCCCACTGACAGGGAAGGATGGGGAGATCAGGAACAACTGCCGGAGGGTTAACAAA
CGCTACTGA

Retrieve as FASTA