Entry information : SbPrx45 (Sobic.002G416500.1 [2.1] / SB02G042840 [1.4])
Entry ID 2752
Creation 2010-01-07 (Christophe Dunand)
Last sequence changes 2010-01-07 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx45 (Sobic.002G416500.1 [2.1] / SB02G042840 [1.4])
Name (synonym) SbPrx45 (Sobic.002G416500.1 [2.1] / SB02G042840 [1.4])
Class Class III peroxidase    [Orthogroup: Prx080]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Roots
Seedlings
Inducers Anaerobic stress
Brassinolide treatment
Gibberellic acid treatment
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx45
start..stop
S start..stop
SiPrx122 558 0 1..318 20..338
ZmPrx70 551 0 26..318 30..321
OsPrx109 475 7e-171 17..318 18..318
AvePrx114-1B 443 5e-158 27..318 31..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 76576334..76576537 204 N° 2 76577688..76577879 192 N° 3 76577977..76578537 561  
join(76576334..76576537,76577688..76577879,76577977..76578537)


exon

Literature and cross-references SbPrx45 (Sobic.002G416500.1 [2.1] / SB02G042840 [1.4])
Literature Plant Genome Database.
DNA ref. Phytozome 12:   chromosome_2 (76576334..76578537)
EST ref. GenBank:   CX614188.1 [5' end]   CX606662.1 [3' end]
Cluster/Prediction ref. UniGene:   Sbi.9250 [3' end]
Protein sequence: SbPrx45 (Sobic.002G416500.1 [2.1] / SB02G042840 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (297)
PWM (Da):   %s   33062.89 (31120.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.82 (8.95) Peptide Signal:   %s   cut: 22 range:22-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAASSLSVLVLLCLAAVASAQLSATFYSRSCPRALATIKSAVTAAVAQEPRMGASLLRLHFHDCFVQGCDASVLLNDTATFTGEQTANPNVGSIRGFGVVDNIKAQVEAVCPGVVSCADILAVAARDSVVALGGPSWRVLLGRRDSTTASLALANSDLPAPSLDLANLTAAFAKKRLSRTDLVALSGAHTIGLSQCKNFRAHIYNDTNVNVAFATLRKVSCPAAAGDGDGNLTPLDTATSTAFDNAYYTNLLSRSGLLHSDQQLFNGGGATDGLVRTYASTPTRFNRDFTAAMIRMGNISPLTGRQGQIRRACSRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1 and 2) and 3 ESTs CX611069, CX606662, CX614188.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTGCTTCTTCCTTGTCAGTGCTGGTGCTCTTGTGCCTAGCAGCGGTGGCCTCGGCGCAACTGTCGGCGACATTCTACTCCAGGTCGTGTCCCAGAGCTCTGGCTACCATCAAG
TCCGCCGTGACGGCCGCGGTTGCACAGGAGCCTCGCATGGGGGCCTCCCTGCTCAGGCTCCACTTCCATGACTGCTTTGTCCAA
GCAAGTCCCGTACCCGTGTCCCTCTCAAGTCTCATT
CTTTCCACTCCTACTTAAATTTGACCACACATCTATCACCATACCGTCCATCCATGATCTCAGTATGCAATACGGCAGTCGTTAGAATTAAGATGGAGTAGTGTATTATTAATCCTAACG
ACCTAGCAACAATCTTTGATGTTAGTATGTGACCACTGGTTAGAAATTACAGTATGTTTGCCATTGCATCATCTTTAGCTACCTCGTTTTTAAGTCTGTTCTCACAGTTTATTACCACTG
TTGTCAGATTATTAACACGACTAGTAGCCGTAGTAGCGTTTGGTAAGGCTCCAGCTCAAAAAAGTCTCCACCTGTCGCTTATCATATATAGAGCAGTTTCTTTGGTGGAGTTAGAGCCAT
TTGATTTTTTTTTTTTTTTGATAAAAACAGCTTCATTGGCAGTTTTGGAATAATTTGTATTAGGTCTGTGAGTGAGAGATAAGAGAAGCTCTTTTTTTTCTGACTTTTGTTTCTCCATAA
AAAAACGGCTTCGGCTCTTTCGGGCTTCTTGCAAGCAGCCATTTTTTAGATATCATTTTGGCTTCTAGAGCGGCAAGAAGCGCGCGAGAGCCGAAGCCCTGGGAAGACAATGAACACTTT
TGACATTTGGAAACATATGTCCAAGACTTATTTTATCCCTTGGTATATATTCAACTTACCAAATATTTACTCTCTATTTTTATTTATTTCTTATGGTTAGCACACAGTTTCCATGAGCTA
GCTGCTCCTTAATTAAGGCCTTGTTTAATTTTCAAAAAGTATCCAAAATTTTTTAAGATTTCATATCATATCGAATCTTACTGCAACTGCATAAAGCATTAAATATAGACGAAAATATTA
TATAGTTTTGTCTGTAATTTGCGAGACGAATCTTTTGAGCCTAGTTAGTTTATGATTGGACAATTTTTATCAAATACAAACAAAAGTTATACAGTACCTACAAGCAAAAAAAATTGGCAG
CTGAACAAGGCTAATTATACAAAATCATGTAACAACTGGTACTACTGCTACAACAACTTATATATTTTGTTTTCTTTATGTAACATCAGTGTGGTGTCCAAATAAAGTAAAATACTTTTG
TACTTGCTCCACATGCATGGACGACGACCCGCAGGGCTGCGATGCGTCGGTGCTGCTGAACGACACGGCCACCTTCACCGGCGAGCAGACCGCTAACCCGAACGTCGGGTCCATCAGAGG
CTTCGGCGTCGTCGACAACATCAAGGCGCAGGTGGAGGCCGTGTGCCCGGGGGTCGTCTCCTGCGCCGACATCCTTGCCGTCGCCGCCCGAGACTCCGTCGTCGCG
GTAAGAAACACCCC
CGGCCGGCCGGCTGACCAGAATTACACGGATCCGATCCCCAGCTAGCTTGTCTTTAATTCGGTAAACGATGTGTGCTGTGCAGCTGGGAGGGCCTTCGTGGAGGGTACTTCTGGGGCGGA
GGGACTCGACGACGGCGAGCTTAGCTCTGGCCAACAGCGACCTGCCAGCGCCGTCCCTGGACCTCGCCAACCTCACCGCCGCGTTCGCCAAGAAGCGGCTCAGCAGGACGGACCTGGTTG
CTCTCTCAGGGGCGCACACGATCGGGCTGTCGCAGTGCAAGAACTTCCGGGCGCACATATACAACGACACCAACGTGAACGTGGCGTTCGCGACGCTGCGCAAGGTCAGCTGCCCCGCGG
CGGCCGGCGACGGCGACGGCAACCTGACGCCGCTGGACACCGCAACGTCCACCGCGTTCGACAACGCCTACTACACCAACCTGCTGTCCCGGAGCGGGTTGCTGCACTCCGACCAGCAGC
TGTTCAACGGCGGCGGCGCCACGGACGGACTGGTCCGCACGTACGCGTCCACGCCGACGAGGTTCAACAGGGACTTCACGGCGGCCATGATCAGGATGGGCAACATCAGCCCGCTCACTG
GGAGGCAGGGCCAGATCAGGCGCGCCTGCTCCAGGGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTGCTTCTTCCTTGTCAGTGCTGGTGCTCTTGTGCCTAGCAGCGGTGGCCTCGGCGCAACTGTCGGCGACATTCTACTCCAGGTCGTGTCCCAGAGCTCTGGCTACCATCAAG
TCCGCCGTGACGGCCGCGGTTGCACAGGAGCCTCGCATGGGGGCCTCCCTGCTCAGGCTCCACTTCCATGACTGCTTTGTCCAA
GGCTGCGATGCGTCGGTGCTGCTGAACGACACGGCC
ACCTTCACCGGCGAGCAGACCGCTAACCCGAACGTCGGGTCCATCAGAGGCTTCGGCGTCGTCGACAACATCAAGGCGCAGGTGGAGGCCGTGTGCCCGGGGGTCGTCTCCTGCGCCGAC
ATCCTTGCCGTCGCCGCCCGAGACTCCGTCGTCGCG
CTGGGAGGGCCTTCGTGGAGGGTACTTCTGGGGCGGAGGGACTCGACGACGGCGAGCTTAGCTCTGGCCAACAGCGACCTGCCA
GCGCCGTCCCTGGACCTCGCCAACCTCACCGCCGCGTTCGCCAAGAAGCGGCTCAGCAGGACGGACCTGGTTGCTCTCTCAGGGGCGCACACGATCGGGCTGTCGCAGTGCAAGAACTTC
CGGGCGCACATATACAACGACACCAACGTGAACGTGGCGTTCGCGACGCTGCGCAAGGTCAGCTGCCCCGCGGCGGCCGGCGACGGCGACGGCAACCTGACGCCGCTGGACACCGCAACG
TCCACCGCGTTCGACAACGCCTACTACACCAACCTGCTGTCCCGGAGCGGGTTGCTGCACTCCGACCAGCAGCTGTTCAACGGCGGCGGCGCCACGGACGGACTGGTCCGCACGTACGCG
TCCACGCCGACGAGGTTCAACAGGGACTTCACGGCGGCCATGATCAGGATGGGCAACATCAGCCCGCTCACTGGGAGGCAGGGCCAGATCAGGCGCGCCTGCTCCAGGGTCAACTAG

Retrieve as FASTA