Entry information : SbPrx124 (Sobic.009G145600.1 [2.1] / SB09G021040 [1.4])
Entry ID 2753
Creation 2006-01-18 (Christophe Dunand)
Last sequence changes 2006-01-18 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx124 (Sobic.009G145600.1 [2.1] / SB09G021040 [1.4])
Name (synonym) SbPrx124 (Sobic.009G145600.1 [2.1] / SB09G021040 [1.4])
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx124
start..stop
S start..stop
SbPrx123 570 0 1..320 1..317
SbPrx125 554 0 1..323 1..320
SiPrx101 523 0 1..323 1..317
SbPrx120 503 0 1..319 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50463444..50463701 258 N° 2 50463145..50463339 195 N° 3 50462870..50463032 163 N° 4 50462390..50462745 356
complement(join(50462390..50462745,50462870..50463032,50463145..50463339,5046344 4..50463701))


exon

Literature and cross-references SbPrx124 (Sobic.009G145600.1 [2.1] / SB09G021040 [1.4])
Literature Plant Genome Database
DNA ref. Phytozome 12:   chromosome_9 (50463701..50462390)
Protein sequence: SbPrx124 (Sobic.009G145600.1 [2.1] / SB09G021040 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (291)
PWM (Da):   %s   34301.3 (31198.7)  
PI (pH):   %s   7.97 (7.44) Peptide Signal:   %s   cut: 33 range:33-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSRISSPPAWLLAAHCALMLGALAGAARGHSPTAGAALSSAFYDQSCPGAYGIVRRVIQAARVSDPRIPASLIRLHFHDCFVNGCDGSLLLDDDLPAIQTEKNVPANNNSARGFPVVDGIKRALEEACPGIVSCADILALAAEISVELAGGPRWRVLLGRRDGTTTNVQSANNLPSPFDTLAKLQEKFRNVNLDDTDLVALQGAHTFGKVQCQFTRHNCSAGQPQGALENLDQVTPTVFDNKYYGNLLHGQAQLSSDQVMLSDPAAPTTTAPVVHRFASNQKDFFANFVTSMIKMGNISPLTGKDGEIRKNCRRVNSKGH

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCCTCTCGCATCTCGTCCCCTCCGGCGTGGCTGTTGGCCGCGCACTGCGCTCTCATGCTCGGCGCCCTGGCTGGAGCCGCCCGTGGCCACTCTCCGACCGCCGGCGCGGCG
CTTAGCTCCGCGTTCTACGACCAGTCGTGCCCCGGCGCCTACGGCATCGTCCGTCGCGTCATCCAGGCCGCGCGCGTCTCCGACCCGCGCATCCCGGCCAGTCTCATCCGCCTCCACTTC
CATGACTGCTTCGTCAAC
GTACGTGACCTGATCGATAGTGCTCCTGTAGCATGTACGCAGCTACATAAGCCTGCTTGCATCATCTGACACACGAATGAGCGTCAAATATTGTTGGTTTTC
AGGGTTGCGACGGCTCCCTTCTTCTGGACGACGATCTCCCGGCGATCCAGACCGAGAAGAACGTGCCAGCCAACAACAACTCGGCGCGCGGCTTCCCGGTGGTCGACGGCATCAAGCGGG
CGCTGGAGGAAGCGTGCCCGGGCATCGTCTCCTGCGCTGATATCCTTGCCCTCGCAGCCGAGATCTCCGTTGAACTC
GTAAGCATCTCCGATCCTCTATATCCTCTTGCATTGAAACTAT
ATCTCTAGCTTCTCGCCTGAACTCAACTGATGGGAAAGAATCGTGCACGGACGAACTGGGCGCGCGCAGGCTGGAGGACCACGGTGGAGGGTGCTTCTTGGCCGCCGAGACGGCACGACG
ACCAACGTCCAGAGTGCTAACAACCTTCCCAGCCCTTTCGACACCCTTGCCAAGCTCCAGGAGAAGTTCAGAAATGTCAACCTCGACGACACTGACCTCGTCGCCCTCCAAG
GTAACGTA
CACAGGCTGAGCAAATAATACTATTTTTGCACGTACAGTTCAAACTTGCGAAGTTACTTTTTATATACGGCGTGCACACACTGATGATATCAACAAACAATAAATTTGTACTCCAGGAGC
GCACACATTTGGCAAAGTCCAGTGCCAGTTCACGCGTCACAACTGCTCGGCGGGGCAACCACAGGGTGCACTAGAGAACCTGGATCAGGTTACACCCACTGTGTTTGACAACAAGTATTA
TGGCAACCTCTTGCACGGCCAAGCGCAGCTATCGTCCGACCAGGTCATGCTATCCGACCCTGCGGCACCGACAACCACTGCACCTGTTGTTCACCGGTTCGCGAGTAACCAAAAGGATTT
CTTTGCGAACTTCGTGACATCCATGATTAAGATGGGCAACATCAGCCCGCTGACAGGAAAGGATGGAGAGATCAGAAAGAACTGCCGGAGGGTCAATAGCAAAGGCCATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCCTCTCGCATCTCGTCCCCTCCGGCGTGGCTGTTGGCCGCGCACTGCGCTCTCATGCTCGGCGCCCTGGCTGGAGCCGCCCGTGGCCACTCTCCGACCGCCGGCGCGGCG
CTTAGCTCCGCGTTCTACGACCAGTCGTGCCCCGGCGCCTACGGCATCGTCCGTCGCGTCATCCAGGCCGCGCGCGTCTCCGACCCGCGCATCCCGGCCAGTCTCATCCGCCTCCACTTC
CATGACTGCTTCGTCAAC
GGTTGCGACGGCTCCCTTCTTCTGGACGACGATCTCCCGGCGATCCAGACCGAGAAGAACGTGCCAGCCAACAACAACTCGGCGCGCGGCTTCCCGGTGGTC
GACGGCATCAAGCGGGCGCTGGAGGAAGCGTGCCCGGGCATCGTCTCCTGCGCTGATATCCTTGCCCTCGCAGCCGAGATCTCCGTTGAACTC
GCTGGAGGACCACGGTGGAGGGTGCTT
CTTGGCCGCCGAGACGGCACGACGACCAACGTCCAGAGTGCTAACAACCTTCCCAGCCCTTTCGACACCCTTGCCAAGCTCCAGGAGAAGTTCAGAAATGTCAACCTCGACGACACTGAC
CTCGTCGCCCTCCAAG
GAGCGCACACATTTGGCAAAGTCCAGTGCCAGTTCACGCGTCACAACTGCTCGGCGGGGCAACCACAGGGTGCACTAGAGAACCTGGATCAGGTTACACCCACT
GTGTTTGACAACAAGTATTATGGCAACCTCTTGCACGGCCAAGCGCAGCTATCGTCCGACCAGGTCATGCTATCCGACCCTGCGGCACCGACAACCACTGCACCTGTTGTTCACCGGTTC
GCGAGTAACCAAAAGGATTTCTTTGCGAACTTCGTGACATCCATGATTAAGATGGGCAACATCAGCCCGCTGACAGGAAAGGATGGAGAGATCAGAAAGAACTGCCGGAGGGTCAATAGC
AAAGGCCATTGA

Retrieve as FASTA