Entry information : SbPrx123 (Sobic.009G145500.1 [2.1] / SB09G021030 [1.4])
Entry ID 2755
Creation 2008-11-17 (Christophe Dunand)
Last sequence changes 2008-11-17 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx123 (Sobic.009G145500.1 [2.1] / SB09G021030 [1.4])
Name (synonym) SbPrx123 (Sobic.009G145500.1 [2.1] / SB09G021030 [1.4])
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx123
start..stop
S start..stop
SbPrx124 583 0 1..317 1..320
SbPrx125 568 0 1..316 1..316
SbPrx120 504 0 1..318 1..319
SiPrx101 503 0 1..317 1..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50458472..50458720 249 N° 2 50458171..50458365 195 N° 3 50457902..50458064 163 N° 4 50457432..50457784 353
complement(join(50457432..50457784,50457902..50458064,50458171..50458365,5045847 2..50458720))


exon

Literature and cross-references SbPrx123 (Sobic.009G145500.1 [2.1] / SB09G021030 [1.4])
Literature Plant Genome Database.
DNA ref. Phytozome 12:   chromosome_9 (50458720..50457432)
EST ref. GenBank:   CD228428.1 [5' end]
Protein sequence: SbPrx123 (Sobic.009G145500.1 [2.1] / SB09G021030 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (287)
PWM (Da):   %s   34375.48 (31093.7)  
PI (pH):   %s   8.17 (7.76) Peptide Signal:   %s   cut: 33 range:33-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSRISSPAWLLAAHWHCALLLALAGVARGHAGAALSSAFYDLSCPGAYNVVRRVIQSARVSDPRIPASLIRLHFHDCFVNGCDGSLLLDDDLPAIRTEKNVPANNNSARGFPVVDGIKRALEEACPGIVSCADILALAAEISVELAGGPRWRVLLGRRDGTTTNVQSAKNLPSLFDSLAKLQEKFRNVNLDDTDLVALQGAHTFGKVQCQFTRHNCSAGQPQGALEDLDQVTPTVFDNKYYGNLLHGQAQLPSDQVMLSDPTAPRTTAPVVHRFASNQKDFFTNFVTSMIKMGNISPLTGKDGEIRKNCRRVNTHQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, 3 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCCTCTCGCATCTCGTCTCCTGCGTGGCTGTTAGCCGCGCACTGGCACTGCGCTCTCCTGCTCGCTCTGGCTGGAGTCGCCCGTGGCCACGCCGGCGCGGCGCTGAGCTCC
GCGTTCTACGACCTGTCGTGCCCCGGCGCCTACAACGTCGTCCGTCGCGTCATCCAGAGCGCGCGCGTCTCCGACCCGCGCATCCCGGCCAGTCTCATCCGCCTCCACTTCCATGACTGC
TTCGTCAAC
GTACGTGAGCTGCTGATCAATGCAATTGTGCTCGTGTAGCATGCATGTACGCGGCAGTGCATGCCTTTCATCATCTGACATGAACGAACGCCGAATAATGTTTCAGGGTTG
CGACGGCTCCCTTCTTCTGGACGACGATCTCCCGGCGATCCGGACCGAGAAGAACGTGCCAGCCAACAACAACTCGGCGCGCGGCTTCCCGGTGGTCGACGGCATCAAGCGCGCGCTGGA
GGAAGCGTGCCCGGGCATCGTCTCCTGCGCTGATATCCTTGCCCTCGCAGCAGAGATCTCAGTTGAACTC
GTAAGCGTCTCCTGTATATTTCCTGTTGCATTCAAACTCTGCCTATATAG
CTTCTCGCCTGAAGAGGGACGACACTGACGGAAAAGAATCGTGCACGTAACTGCAGGCTGGAGGACCACGCTGGAGGGTGCTTCTTGGCCGCCGAGACGGCACGACGACCAACGTCCAGA
GTGCCAAGAACCTTCCCAGCCTTTTCGACTCCCTTGCCAAGCTCCAGGAGAAGTTCAGAAACGTCAACCTGGACGACACTGATCTCGTTGCCCTCCAAG
GTAAATACTGAATAATTGATA
GTAGCAATATAAATTTATAGCACGTATACAGTTGAAACTTGCGAAGTTTTTATACGGGTGCACACTGATGATATCAACAACAAATTTCTACTACAGGAGCGCACACATTCGGCAAAGTCC
AGTGCCAGTTCACGCGTCACAACTGCTCGGCGGGGCAACCACAGGGCGCACTAGAGGACCTAGACCAAGTTACACCCACCGTGTTTGACAACAAGTATTATGGCAACCTCTTGCACGGCC
AAGCGCAGTTGCCGTCCGACCAGGTTATGCTATCCGACCCTACGGCACCGAGAACCACTGCACCTGTTGTTCACCGGTTCGCGAGCAACCAAAAGGATTTTTTCACGAACTTTGTGACAT
CCATGATTAAGATGGGGAACATCAGCCCGCTGACAGGGAAGGATGGAGAGATCAGAAAGAACTGCCGGAGGGTCAATACTCATCAATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCCTCTCGCATCTCGTCTCCTGCGTGGCTGTTAGCCGCGCACTGGCACTGCGCTCTCCTGCTCGCTCTGGCTGGAGTCGCCCGTGGCCACGCCGGCGCGGCGCTGAGCTCC
GCGTTCTACGACCTGTCGTGCCCCGGCGCCTACAACGTCGTCCGTCGCGTCATCCAGAGCGCGCGCGTCTCCGACCCGCGCATCCCGGCCAGTCTCATCCGCCTCCACTTCCATGACTGC
TTCGTCAAC
GGTTGCGACGGCTCCCTTCTTCTGGACGACGATCTCCCGGCGATCCGGACCGAGAAGAACGTGCCAGCCAACAACAACTCGGCGCGCGGCTTCCCGGTGGTCGACGGCATC
AAGCGCGCGCTGGAGGAAGCGTGCCCGGGCATCGTCTCCTGCGCTGATATCCTTGCCCTCGCAGCAGAGATCTCAGTTGAACTC
GCTGGAGGACCACGCTGGAGGGTGCTTCTTGGCCGC
CGAGACGGCACGACGACCAACGTCCAGAGTGCCAAGAACCTTCCCAGCCTTTTCGACTCCCTTGCCAAGCTCCAGGAGAAGTTCAGAAACGTCAACCTGGACGACACTGATCTCGTTGCC
CTCCAAG
GAGCGCACACATTCGGCAAAGTCCAGTGCCAGTTCACGCGTCACAACTGCTCGGCGGGGCAACCACAGGGCGCACTAGAGGACCTAGACCAAGTTACACCCACCGTGTTTGAC
AACAAGTATTATGGCAACCTCTTGCACGGCCAAGCGCAGTTGCCGTCCGACCAGGTTATGCTATCCGACCCTACGGCACCGAGAACCACTGCACCTGTTGTTCACCGGTTCGCGAGCAAC
CAAAAGGATTTTTTCACGAACTTTGTGACATCCATGATTAAGATGGGGAACATCAGCCCGCTGACAGGGAAGGATGGAGAGATCAGAAAGAACTGCCGGAGGGTCAATACTCATCAATAG

Retrieve as FASTA