Entry information : SbPrx32 (Sobic.002G258300.1 [2.1] / SB02G029340 [1.4])
Entry ID 2756
Creation 2006-01-18 (Christophe Dunand)
Last sequence changes 2006-01-18 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx32 (Sobic.002G258300.1 [2.1] / SB02G029340 [1.4])
Name (synonym) SbPrx32 (Sobic.002G258300.1 [2.1] / SB02G029340 [1.4])
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx32
start..stop
S start..stop
ZmPrx29 598 0 1..336 1..335
SiPrx123 551 0 27..337 24..330
OsPrx123 517 0 32..336 32..331
TaPrx13 470 2e-168 30..336 28..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 64470096..64470329 234 N° 2 64469234..64469425 192 N° 3 64468556..64469143 588  
complement(join(64468556..64469143,64469234..64469425,64470096..64470329))


exon

Literature and cross-references SbPrx32 (Sobic.002G258300.1 [2.1] / SB02G029340 [1.4])
Literature Plant Genome Database
DNA ref. Phytozome 11:   chromosome_2 (64470329..64468556)
Protein sequence: SbPrx32 (Sobic.002G258300.1 [2.1] / SB02G029340 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (306)
PWM (Da):   %s   35555.93 (32282.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.76 (6.85) Peptide Signal:   %s   cut: 32 range:32-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKRRRRHLLLAAAAVVLVAVAAIPLPSAEAKLSPDYYRSTCPDVEAIVRAVVAKKVNETFVTVPATLRLFFHDCFVEGCDASVMIASRDNDAEKDAPDNVSLAGDGFDTVVRAKAEVEKKCPGVVSCADILAIAARDVVAMSSGPHWTVQLGRLDGLVSKAGNVAGKLPGPNMRVKDLAAMFAKHNLTTLDMVALSGAHTVGFAHCTRFTDRLYRHGGGGNGASVDPSYNPAYARQLMGACPPDVGADIAVDMDPITPTAFDNAYYANLAGGLGLFASDQALYSDGASRPAVRGFAGNQTRFFEAFKDAMVKLGSVGVKTTGRHGEIRRDCTAFNE*

Retrieve as FASTA  
Remarks Complete sequence from Genomic (chromo 2, intron 1 and 2). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAACGAAGACGCAGGCACTTGCTGCTTGCTGCTGCAGCCGTGGTGCTGGTGGCAGTGGCAGCAATACCGCTGCCGTCCGCGGAGGCGAAGCTGTCCCCAGACTACTACCGGTCG
ACGTGCCCGGACGTCGAGGCGATCGTGCGGGCAGTGGTGGCGAAGAAGGTCAATGAGACCTTCGTCACGGTCCCGGCCACGCTCAGGCTCTTCTTCCACGACTGCTTCGTCGAG
GTGAGC
AACATCCATCAGTGTCTGCACCTGCCTGCCTGCGCGTTCGGGCAATCTGAGGCTCTTTTGGCCGAGACCAAGAATCCGTTTAGAAATTAGAACACGGAGGGGATTGTTTTAACCGATTCC
TGTGAAGATCTTGTGTTTTCAACACCTCGCTTTATATTTTACAATCTGAGTCGCTGGTGACTGAAAATTTCTTGATTTGCAATGTCGTAGAGGTTCAGTTCGACAAGGCTTTTCAGCTGC
ATTCAGATCAACTTGCAGATTGCGTCAAGGACCTCTTAGATCAGACTGAATTTGGTAGTGTTAGTGCTAGAAGAAGGACTGACGCGGCAGTAGATGTAGATTATTGGTACGAATGACAGC
TCGATTATTGGCTTCTAATCACGCACTCGTCGGCTGTGCCATGTGACTGCACGACCTTTTCTGTCAACTAGTCTGAATTCTATCAGATAATCAGGTCAGATGTGTCGGACGCCCGTCCCT
GCTGGCAAATCAGCCACCCACCCATTTGTCATCTTCCGACGAGGCGAATACGGAATTTTTATGCTGTCCACGTCATCGTTTCGTTCCACACTCTGAATGTCCAATGGTGAATACGCTTTT
CCAGTTTGCGCGGGGCTGAAACAGAACGAAACTGACATGTTTGTGGTGAAAAATCGACTGGCAGGGCTGTGATGCGTCGGTCATGATCGCGTCCCGCGACAACGACGCCGAGAAGGACGC
GCCCGACAACGTGTCCCTCGCCGGCGACGGCTTCGACACCGTGGTGCGCGCCAAGGCCGAGGTCGAGAAGAAGTGCCCCGGCGTGGTCTCCTGCGCCGACATCCTCGCCATCGCCGCCAG
GGACGTCGTCGCCATG
GTAATTGATTCAGACAAGCTCTCACTTCTTACTGAGCCATGGCAATTCGGTTTCTGATCGATACTGTGTGCTTGTGCAATGGCATTTCAGTCGTCCGGCCCCCA
CTGGACCGTCCAGCTTGGGCGGCTTGACGGGCTCGTCTCCAAGGCCGGCAACGTCGCGGGCAAGTTGCCGGGACCCAACATGCGCGTCAAGGACCTCGCCGCCATGTTCGCCAAGCACAA
CCTCACGACGCTGGACATGGTCGCGCTCTCGGGCGCGCACACCGTCGGGTTCGCGCACTGCACCCGCTTCACGGACCGCCTCTACCGCCACGGCGGCGGCGGCAATGGCGCGTCGGTGGA
CCCGTCGTACAACCCTGCGTACGCGCGGCAGCTCATGGGCGCCTGCCCGCCGGACGTCGGCGCGGACATCGCCGTCGATATGGACCCGATCACACCGACCGCCTTCGATAACGCCTACTA
CGCCAACCTCGCCGGCGGCCTGGGCCTGTTCGCCTCCGACCAGGCGCTGTACAGCGACGGCGCGTCGCGGCCGGCGGTGAGGGGCTTCGCTGGGAACCAGACGCGCTTCTTCGAGGCGTT
CAAGGACGCCATGGTGAAGCTGGGCAGTGTTGGGGTGAAGACCACCGGCAGGCACGGGGAGATCAGAAGAGACTGCACCGCATTCAACGAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAACGAAGACGCAGGCACTTGCTGCTTGCTGCTGCAGCCGTGGTGCTGGTGGCAGTGGCAGCAATACCGCTGCCGTCCGCGGAGGCGAAGCTGTCCCCAGACTACTACCGGTCG
ACGTGCCCGGACGTCGAGGCGATCGTGCGGGCAGTGGTGGCGAAGAAGGTCAATGAGACCTTCGTCACGGTCCCGGCCACGCTCAGGCTCTTCTTCCACGACTGCTTCGTCGAG
GGCTGT
GATGCGTCGGTCATGATCGCGTCCCGCGACAACGACGCCGAGAAGGACGCGCCCGACAACGTGTCCCTCGCCGGCGACGGCTTCGACACCGTGGTGCGCGCCAAGGCCGAGGTCGAGAAG
AAGTGCCCCGGCGTGGTCTCCTGCGCCGACATCCTCGCCATCGCCGCCAGGGACGTCGTCGCCATG
TCGTCCGGCCCCCACTGGACCGTCCAGCTTGGGCGGCTTGACGGGCTCGTCTCC
AAGGCCGGCAACGTCGCGGGCAAGTTGCCGGGACCCAACATGCGCGTCAAGGACCTCGCCGCCATGTTCGCCAAGCACAACCTCACGACGCTGGACATGGTCGCGCTCTCGGGCGCGCAC
ACCGTCGGGTTCGCGCACTGCACCCGCTTCACGGACCGCCTCTACCGCCACGGCGGCGGCGGCAATGGCGCGTCGGTGGACCCGTCGTACAACCCTGCGTACGCGCGGCAGCTCATGGGC
GCCTGCCCGCCGGACGTCGGCGCGGACATCGCCGTCGATATGGACCCGATCACACCGACCGCCTTCGATAACGCCTACTACGCCAACCTCGCCGGCGGCCTGGGCCTGTTCGCCTCCGAC
CAGGCGCTGTACAGCGACGGCGCGTCGCGGCCGGCGGTGAGGGGCTTCGCTGGGAACCAGACGCGCTTCTTCGAGGCGTTCAAGGACGCCATGGTGAAGCTGGGCAGTGTTGGGGTGAAG
ACCACCGGCAGGCACGGGGAGATCAGAAGAGACTGCACCGCATTCAACGAGTAG

Retrieve as FASTA