Entry information : SbPrx121 (Sobic.009G144800.1 [2.1] / SB09G020980 [1.4])
Entry ID 2758
Creation 2008-11-19 (Christophe Dunand)
Last sequence changes 2008-11-19 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx121 (Sobic.009G144800.1 [2.1] / SB09G020980 [1.4])
Name (synonym) SbPrx121 (Sobic.009G144800.1 [2.1] / SB09G020980 [1.4])
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx121
start..stop
S start..stop
SbPrx122 535 0 1..325 1..325
SiPrx101 504 0 1..325 1..315
SbPrx124 502 0 3..325 2..321
SbPrx120 495 2e-178 3..324 2..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50414518..50414784 267 N° 2 50414930..50415124 195 N° 3 50415280..50415442 163 N° 4 50415545..50415897 353
join(50414518..50414784,50414930..50415124,50415280..50415442,50415545..50415897 )


exon

Literature and cross-references SbPrx121 (Sobic.009G144800.1 [2.1] / SB09G020980 [1.4])
Literature Plant Genome Database.
DNA ref. Phytozome 12:   chromosome_9 (50414518..50415897)
EST ref. GenBank:   EH411845.1 [3' end]
Protein sequence: SbPrx121 (Sobic.009G144800.1 [2.1] / SB09G020980 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (295)
PWM (Da):   %s   34827.6 (32039.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.76 (7.50) Peptide Signal:   %s   cut: 31 range:31-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAASSRISSLGLLIAAHCALLLALAGAAAHGRGHAPSGGGVALSSAFYDESCPSAHDVARRVIQDARVSDPRLPASLVRLHFHDCFANGCDGSLLLDDDNPAIQSEKHVPGNDKSARGFEVVDDIKSALEKACPGIVSCADILALAAEISVELAGGPRWKVLLGRRDGTTTNIESASNLPSPFDTLDKLQEKFRNFNLDDTDLVALQAHTFGKVHCQFTQQNCTAGQSRGRGALENLDQVTPKVFDNKYYNNLLKGRAQLRSDQVMLSEPSAAATTAPIVHRFARNQRDFFRNFAASMIKMGNISPLTGKDGEIRNNCRRVNKR

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, 3 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCAGCTTCCTCGCGCATCTCGTCTCTGGGGTTGCTGATAGCCGCGCACTGCGCGCTCTTGCTCGCTTTGGCTGGAGCTGCTGCTCACGGTCGCGGTCACGCTCCCAGCGGCGGC
GGCGTGGCGCTGAGCTCCGCGTTCTACGACGAGTCGTGCCCCAGCGCCCACGACGTCGCCCGGCGCGTCATCCAGGACGCGCGCGTCTCCGACCCGCGCCTCCCGGCCAGCCTCGTCCGC
CTCCACTTCCACGACTGCTTCGCCAAC
GTGAGCACCAGTGCTTCTTCTTGCCCGGCCCGTGGCTGATCCGTATTGCTGGTGTAGGATGTAGGATGTACGCGGCAGCTAAGTGCGTTCGTT
GCAGCATATGACAACTACTGGCATGAAATGAACGAACGTCCAAATGTTTCAGGGTTGCGATGGCTCCCTTCTGCTGGACGACGATAACCCGGCGATCCAGTCCGAGAAACACGTGCCCGG
CAACGACAAATCCGCGCGTGGCTTCGAGGTTGTCGATGACATCAAGAGCGCGCTGGAGAAAGCGTGCCCTGGCATCGTCTCCTGCGCCGACATCCTCGCCCTGGCAGCCGAGATCTCCGT
CGAACTC
GTAAGAACCCCATACCTAGCTAGCTTCTTCAATTGAACAACTAGCGTGTTTCGTACTTGTACTATAGCTAGCTCTAGCTTCCCAATCTGCTCCACGTTAATCTTGCGATCTCC
ACTGAGAACTGACGGAATCATGCATCAACTGCGTGCTTGCAGGCTGGAGGGCCACGATGGAAGGTGCTGCTCGGCCGGCGAGACGGCACGACGACTAACATCGAGAGCGCCAGTAACCTA
CCGAGCCCTTTCGACACCCTGGACAAGCTCCAGGAGAAGTTCAGAAACTTCAACCTCGACGACACTGACCTCGTCGCCCTCCAAG
GTAATCTACTTACCGTTGTAGCAACACAAATAGTT
CAAATTGTCGAAGCTCAAGATAGCCTTGACACAAATCTCAACATATTTCCTATTTCTACATCAGGAGCGCACACATTCGGTAAAGTCCATTGCCAGTTCACGCAACAGAATTGCACGGCC
GGCCAGTCCCGTGGCCGCGGCGCACTGGAGAACCTGGATCAGGTCACACCCAAGGTGTTTGACAACAAGTACTACAATAACCTCTTAAAGGGCCGTGCTCAGCTCCGGTCCGACCAGGTT
ATGCTATCGGAACCTTCTGCTGCGGCGACTACTGCTCCCATTGTTCATCGGTTCGCAAGGAACCAACGGGATTTTTTCAGAAACTTTGCGGCATCCATGATTAAGATGGGAAACATTAGC
CCGCTGACAGGAAAGGATGGGGAGATCAGGAACAACTGCCGGAGGGTCAACAAACGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCAGCTTCCTCGCGCATCTCGTCTCTGGGGTTGCTGATAGCCGCGCACTGCGCGCTCTTGCTCGCTTTGGCTGGAGCTGCTGCTCACGGTCGCGGTCACGCTCCCAGCGGCGGC
GGCGTGGCGCTGAGCTCCGCGTTCTACGACGAGTCGTGCCCCAGCGCCCACGACGTCGCCCGGCGCGTCATCCAGGACGCGCGCGTCTCCGACCCGCGCCTCCCGGCCAGCCTCGTCCGC
CTCCACTTCCACGACTGCTTCGCCAAC
GGTTGCGATGGCTCCCTTCTGCTGGACGACGATAACCCGGCGATCCAGTCCGAGAAACACGTGCCCGGCAACGACAAATCCGCGCGTGGCTTC
GAGGTTGTCGATGACATCAAGAGCGCGCTGGAGAAAGCGTGCCCTGGCATCGTCTCCTGCGCCGACATCCTCGCCCTGGCAGCCGAGATCTCCGTCGAACTC
GCTGGAGGGCCACGATGG
AAGGTGCTGCTCGGCCGGCGAGACGGCACGACGACTAACATCGAGAGCGCCAGTAACCTACCGAGCCCTTTCGACACCCTGGACAAGCTCCAGGAGAAGTTCAGAAACTTCAACCTCGAC
GACACTGACCTCGTCGCCCTCCAAG
CGCACACATTCGGTAAAGTCCATTGCCAGTTCACGCAACAGAATTGCACGGCCGGCCAGTCCCGTGGCCGCGGCGCACTGGAGAACCTGGATCAG
GTCACACCCAAGGTGTTTGACAACAAGTACTACAATAACCTCTTAAAGGGCCGTGCTCAGCTCCGGTCCGACCAGGTTATGCTATCGGAACCTTCTGCTGCGGCGACTACTGCTCCCATT
GTTCATCGGTTCGCAAGGAACCAACGGGATTTTTTCAGAAACTTTGCGGCATCCATGATTAAGATGGGAAACATTAGCCCGCTGACAGGAAAGGATGGGGAGATCAGGAACAACTGCCGG
AGGGTCAACAAACGCTAG

Retrieve as FASTA