Entry information : SbPrx140 (Sobic.010G245300.1 [2.1] / Sb10g028460 [1.4])
Entry ID 2762
Creation 2008-11-19 (Christophe Dunand)
Last sequence changes 2008-11-19 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx140 (Sobic.010G245300.1 [2.1] / Sb10g028460 [1.4])
Name (synonym) SbPrx140 (Sobic.010G245300.1 [2.1] / Sb10g028460 [1.4])
Class Class III peroxidase    [Orthogroup: Prx124]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx140
start..stop
S start..stop
ZmPrx134 513 0 18..317 22..320
SiPrx44 505 0 1..317 2..320
OsPrx92 438 2e-156 1..317 1..314
OsPrx93 436 2e-155 1..317 1..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58274504..58274713 210 N° 2 58274210..58274407 198 N° 3 58273915..58274074 160 N° 4 58273328..58273713 386
complement(join(58273328..58273713,58273915..58274074,58274210..58274407,5827450 4..58274713))


exon

Literature and cross-references SbPrx140 (Sobic.010G245300.1 [2.1] / Sb10g028460 [1.4])
Literature JGI
DNA ref. Phytozome 12:   chromosome_10 (58274713..58273328)
Protein sequence: SbPrx140 (Sobic.010G245300.1 [2.1] / Sb10g028460 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (296)
PWM (Da):   %s   33715.52 (31430.2)  
PI (pH):   %s   4.67 (4.52) Peptide Signal:   %s   cut: 22 range:22-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRRLQLLAAVFLLAFTPMAAAKPQLRPDYYAGVCPNLESIVRGAVQQSVALSPLSAPATLRLFFHDCAVRGCDASVMLINPAGDDEWRSLDGMTLKLEGFSTVMNAKAAVDSDPQCRNRVSCADILALAARDSVFLSGGPDYTVELGRFDGRVSTCGSVVVPHGSFDLDQLNAFFSGLGLNQTDMIALSGGHTIGAASCGFFAYRVGEDPAMDPGLAQELLGRCPGDGPAAGFAFLDSTTPLRFDNEYYRNLRGGMGVLASDQVLYADPRSRGDVERYAADQDAFFGDFAAAMTRLGRVGVRTAADGEIRCDCRFPN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 10, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCGCCTCCAGCTCCTGGCCGCCGTCTTCCTGCTCGCGTTCACGCCGATGGCGGCGGCCAAGCCGCAGCTGAGGCCGGACTACTACGCCGGCGTCTGCCCGAACCTCGAGAGCATT
GTCCGCGGCGCCGTGCAGCAGTCCGTGGCGCTCTCGCCGCTCTCCGCCCCGGCCACGCTCCGCCTCTTCTTCCACGACTGCGCCGTCCGG
GTACGTGCCATTAATCATTATAGGAGCATT
ACTGATGCTGCCGATCGTCAGAGCTTGGGATCGTTGATTCGCCACTCTTGTGATCTGTGAATTAAGGGCTGCGACGCGTCGGTGATGCTGATCAACCCTGCCGGCGACGACGAGTGGCGG
AGCCTCGACGGCATGACGCTGAAGCTGGAGGGCTTCAGCACGGTGATGAACGCCAAGGCGGCGGTGGACAGCGACCCGCAGTGCCGGAACAGGGTGTCCTGCGCCGACATCCTCGCCCTC
GCCGCCAGGGATTCCGTGTTCCTG
GTAAGTGCGCGAACGGCGAACACCAAGTCATGCACCACGCATGCTGCTCTGCTCCTCGATTGCTTTCGTTCTCGATCGAGCTGATCGTGACTGTCG
TCTCTCTCGCGTGAACACACGTACGTACGGCCGCCGCAGAGCGGAGGGCCAGACTACACGGTGGAGCTGGGCAGGTTCGACGGCAGGGTGTCGACTTGCGGCAGCGTCGTGGTTCCCCAT
GGCTCGTTCGACCTCGACCAGCTCAACGCCTTCTTCTCCGGCCTCGGCCTCAACCAGACCGACATGATCGCGCTCTCAG
GTACAAATATCCACGCGCACGTGTGCATGCATATATATACA
AATGTGTCAGCTGCTAGCTAGTGGAACACGCCAAGAGCATGCATGCATGCATGCTGCCGTGTTTAGTTTACTACTACTACTACTACTACTAGGAGCATCCTGCACCATTGCAGTAATGCA
TGCTCGTCGCTAACGGCCGTTCTTGCAATAATGCAAGCAGGGGGTCACACGATCGGCGCGGCGTCGTGCGGCTTCTTCGCGTACCGGGTGGGCGAGGATCCGGCCATGGACCCGGGGCTC
GCGCAGGAGCTCCTCGGCCGCTGCCCCGGGGACGGGCCGGCGGCAGGGTTCGCGTTCCTGGACAGCACGACGCCGCTGCGGTTCGACAACGAGTACTACCGGAACCTGCGCGGCGGGATG
GGGGTCCTGGCCTCCGACCAGGTGCTGTACGCCGACCCGAGGTCCCGCGGCGACGTCGAGCGCTACGCGGCGGACCAGGACGCCTTCTTCGGCGACTTCGCCGCCGCCATGACAAGGCTC
GGCAGGGTCGGGGTCCGCACGGCGGCCGACGGCGAGATACGCTGCGACTGCAGGTTCCCCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCGCCTCCAGCTCCTGGCCGCCGTCTTCCTGCTCGCGTTCACGCCGATGGCGGCGGCCAAGCCGCAGCTGAGGCCGGACTACTACGCCGGCGTCTGCCCGAACCTCGAGAGCATT
GTCCGCGGCGCCGTGCAGCAGTCCGTGGCGCTCTCGCCGCTCTCCGCCCCGGCCACGCTCCGCCTCTTCTTCCACGACTGCGCCGTCCGG
GGCTGCGACGCGTCGGTGATGCTGATCAAC
CCTGCCGGCGACGACGAGTGGCGGAGCCTCGACGGCATGACGCTGAAGCTGGAGGGCTTCAGCACGGTGATGAACGCCAAGGCGGCGGTGGACAGCGACCCGCAGTGCCGGAACAGGGTG
TCCTGCGCCGACATCCTCGCCCTCGCCGCCAGGGATTCCGTGTTCCTG
AGCGGAGGGCCAGACTACACGGTGGAGCTGGGCAGGTTCGACGGCAGGGTGTCGACTTGCGGCAGCGTCGTG
GTTCCCCATGGCTCGTTCGACCTCGACCAGCTCAACGCCTTCTTCTCCGGCCTCGGCCTCAACCAGACCGACATGATCGCGCTCTCAG
GGGGTCACACGATCGGCGCGGCGTCGTGCGGC
TTCTTCGCGTACCGGGTGGGCGAGGATCCGGCCATGGACCCGGGGCTCGCGCAGGAGCTCCTCGGCCGCTGCCCCGGGGACGGGCCGGCGGCAGGGTTCGCGTTCCTGGACAGCACGACG
CCGCTGCGGTTCGACAACGAGTACTACCGGAACCTGCGCGGCGGGATGGGGGTCCTGGCCTCCGACCAGGTGCTGTACGCCGACCCGAGGTCCCGCGGCGACGTCGAGCGCTACGCGGCG
GACCAGGACGCCTTCTTCGGCGACTTCGCCGCCGCCATGACAAGGCTCGGCAGGGTCGGGGTCCGCACGGCGGCCGACGGCGAGATACGCTGCGACTGCAGGTTCCCCAACTGA

Retrieve as FASTA