Entry information : SbPrx101 (Sobic.006G277800.1 [2.1] / Sb06g033870 [1.4])
Entry ID 2764
Creation 2008-10-17 (Christophe Dunand)
Last sequence changes 2008-10-17 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx101 (Sobic.006G277800.1 [2.1] / Sb06g033870 [1.4])
Name (synonym) SbPrx101 (Sobic.006G277800.1 [2.1] / Sb06g033870 [1.4])
Class Class III peroxidase    [Orthogroup: Prx070]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Callus
Cell culture
Seedlings
Inducers Ethylene treatment
Phosphate starvation
Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx101
start..stop
S start..stop
ZmPrx[P]47 534 0 3..346 9..337
SiPrx98 453 2e-161 36..332 23..319
OsPrx64 337 1e-115 38..346 31..338
TaPrx66 333 8e-114 42..346 37..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 61807121..61807369 249 N° 2 61806206..61806997 792  
complement(join(61806206..61806997,61807121..61807369))


exon

Literature and cross-references SbPrx101 (Sobic.006G277800.1 [2.1] / Sb06g033870 [1.4])
Literature Cordonnier-Pratt,M.-M., Wentzel,V., Suzuki,Y., Sugano,S., Klein
,R.R., Liang,C., Sun,F., Sullivan,R., Shah,M., Rathore,K., Eastman ,A. and Pratt,L.H. An EST database from Sorghum: callus culture and cell suspension. Unpublished (2003)
DNA ref. Phytozome 12:   chromosome_6 (61807369..61806206)
Protein sequence: SbPrx101 (Sobic.006G277800.1 [2.1] / Sb06g033870 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (328)
PWM (Da):   %s   35743.21 (34134.3)  
PI (pH):   %s   6.61 (6.61) Peptide Signal:   %s   cut: 19 range:19-346
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAVMAIGLLLAGAVVGAVVPPHHDHLQLVIDTDGGLSLDFHAASCPQLEGIVRAAVQAERGQDVQVTAGLLRIFFHDCLPQGCDASILLDGEKAFGPNASLQPRALQLIESIRAKVHAVCGATVSCADIIALATRDAVSLAGGPSIAMPQGRTDSLRPATNAEVNTLPSPFSDVSTLLGTFSRRGLADPADLVALSGGHTVGKASCGFIRGNDDFSRRLAANCSAGRTGKQSLDVITPDAFDNRYFVALRSTQGVLLSDQGLAGDRRTARFVTAFASNQAAFFNQFAKSMVKLGSIKATAAGEIRRNCFRPNGRVSFDDVSALTLTGDDAAAVATSDEGFAASA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, intron 1) and 23 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTGCTGTCATGGCCATTGGCCTGCTGTTGGCCGGCGCCGTCGTCGGCGCAGTAGTGCCGCCTCATCATGATCATCTTCAGCTGGTGATTGACACTGACGGTGGTTTGTCGCTG
GACTTCCACGCGGCGTCGTGCCCGCAGCTGGAGGGCATCGTGCGCGCCGCCGTGCAGGCCGAGCGAGGCCAGGACGTCCAAGTCACCGCCGGCCTCCTCCGCATCTTCTTCCATGACTGC
CTCCCGCAG
GTACCTCATATCTTCTGTATGCATGTATCATGCATGTACAGTACTATATATGTAACGATATATATATATATATATATATATATATATATATATATATATATATATATATAT
ATAAAACTATAGGGGTGCGACGCGTCCATCCTTCTGGACGGCGAGAAGGCCTTTGGTCCCAATGCTTCTCTACAGCCACGGGCGCTGCAGCTCATCGAGAGCATCCGCGCCAAGGTGCAC
GCCGTGTGCGGCGCCACGGTCTCCTGCGCCGACATCATCGCGCTCGCCACCCGCGACGCCGTCAGCCTGGCCGGAGGACCGTCCATCGCGATGCCCCAGGGCCGCACCGACAGCCTCAGG
CCGGCCACCAACGCCGAGGTAAACACCCTCCCGTCGCCCTTCTCCGACGTGAGCACGCTCCTCGGCACCTTCAGCCGCAGGGGCCTCGCCGACCCCGCCGACCTCGTCGCGCTCTCCGGC
GGCCACACCGTGGGGAAGGCCAGCTGCGGCTTCATCAGGGGGAACGACGACTTCTCCCGGAGGCTCGCCGCGAACTGCTCCGCCGGTCGCACCGGGAAGCAGAGCCTGGACGTCATCACG
CCCGACGCCTTCGACAACAGGTACTTCGTCGCGCTGAGGAGCACCCAGGGGGTACTGCTCTCTGACCAGGGCCTCGCCGGCGACCGGCGCACGGCCCGCTTCGTCACCGCCTTCGCCAGC
AACCAGGCCGCCTTCTTCAACCAGTTCGCCAAGTCCATGGTCAAGCTGGGCAGCATCAAGGCAACCGCCGCCGGCGAGATACGCCGCAACTGCTTCAGGCCTAACGGCCGCGTCAGCTTC
GACGACGTCAGTGCTCTCACTCTCACCGGTGATGATGCCGCCGCCGTCGCTACCAGCGACGAGGGCTTTGCAGCCTCTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTGCTGTCATGGCCATTGGCCTGCTGTTGGCCGGCGCCGTCGTCGGCGCAGTAGTGCCGCCTCATCATGATCATCTTCAGCTGGTGATTGACACTGACGGTGGTTTGTCGCTG
GACTTCCACGCGGCGTCGTGCCCGCAGCTGGAGGGCATCGTGCGCGCCGCCGTGCAGGCCGAGCGAGGCCAGGACGTCCAAGTCACCGCCGGCCTCCTCCGCATCTTCTTCCATGACTGC
CTCCCGCAG
GGGTGCGACGCGTCCATCCTTCTGGACGGCGAGAAGGCCTTTGGTCCCAATGCTTCTCTACAGCCACGGGCGCTGCAGCTCATCGAGAGCATCCGCGCCAAGGTGCACGCC
GTGTGCGGCGCCACGGTCTCCTGCGCCGACATCATCGCGCTCGCCACCCGCGACGCCGTCAGCCTGGCCGGAGGACCGTCCATCGCGATGCCCCAGGGCCGCACCGACAGCCTCAGGCCG
GCCACCAACGCCGAGGTAAACACCCTCCCGTCGCCCTTCTCCGACGTGAGCACGCTCCTCGGCACCTTCAGCCGCAGGGGCCTCGCCGACCCCGCCGACCTCGTCGCGCTCTCCGGCGGC
CACACCGTGGGGAAGGCCAGCTGCGGCTTCATCAGGGGGAACGACGACTTCTCCCGGAGGCTCGCCGCGAACTGCTCCGCCGGTCGCACCGGGAAGCAGAGCCTGGACGTCATCACGCCC
GACGCCTTCGACAACAGGTACTTCGTCGCGCTGAGGAGCACCCAGGGGGTACTGCTCTCTGACCAGGGCCTCGCCGGCGACCGGCGCACGGCCCGCTTCGTCACCGCCTTCGCCAGCAAC
CAGGCCGCCTTCTTCAACCAGTTCGCCAAGTCCATGGTCAAGCTGGGCAGCATCAAGGCAACCGCCGCCGGCGAGATACGCCGCAACTGCTTCAGGCCTAACGGCCGCGTCAGCTTCGAC
GACGTCAGTGCTCTCACTCTCACCGGTGATGATGCCGCCGCCGTCGCTACCAGCGACGAGGGCTTTGCAGCCTCTGCTTAA

Retrieve as FASTA