Entry information : SbPrx52 (Sobic.003G120900.1 [2.1] / SB03G010230 [1.4])
Entry ID 2766
Creation 2008-10-17 (Christophe Dunand)
Last sequence changes 2008-10-17 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx52 (Sobic.003G120900.1 [2.1] / SB03G010230 [1.4])
Name (synonym) SbPrx52 (Sobic.003G120900.1 [2.1] / SB03G010230 [1.4])
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx52
start..stop
S start..stop
SiPrx10 669 0 1..347 1..347
ZmPrx46 628 0 1..347 1..353
BdiPrx53 593 0 1..345 1..346
OsPrx05 580 0 1..347 1..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11066204..11066467 264 N° 2 11065821..11066012 192 N° 3 11065448..11065613 166 N° 4 11064605..11065026 422
complement(join(11064605..11065026,11065448..11065613,11065821..11066012,1106620 4..11066467))


exon

Literature and cross-references SbPrx52 (Sobic.003G120900.1 [2.1] / SB03G010230 [1.4])
Literature Plant Genome Database.
DNA ref. Phytozome 12:   chromosome_3 (11066467..11064605)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.57315.1
Protein sequence: SbPrx52 (Sobic.003G120900.1 [2.1] / SB03G010230 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   347 (324)
PWM (Da):   %s   38057.39 (35718.1) Transmb domain:   %s   i2-24o
PI (pH):   %s   7.03 (7.03) Peptide Signal:   %s   cut: 24 range:24-347
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASINIVLGAIFIASFYLSGSLAFPPGHDEGAHPIGNGPISGLSTDYYKFTCPQADEIVVPILKKAIAKEPRIAASLLRLLFHDCFVQGCDASVLLDDAEEVVSEKKAIPNKNSIRGFEVIDEIKAALEEACPNTVSCADTIALAARGSTVLSGGPYWELPLGRRDSKTANMKLANKNLPPPNATLHRLIKFFQRQGLDKVDLVALSGSHTIGKARCVSFKQRLYNQHRDNRPDNTLEKSFYHTLASACPHTGGDDNIRSLDFVSPSQFDNSYYKLILEGKGLLNSDEVLWTGKDPEIAGLVKSYAENEQLFFEHYVNSIIKMGNINPLMGYNGEIRKNCHRVNQDI

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAATCAATATAGTTCTTGGTGCAATTTTCATTGCTTCCTTCTACTTATCTGGCTCCCTTGCCTTCCCTCCTGGTCACGATGAGGGAGCCCATCCAATTGGAAATGGTCCAATC
TCAGGTCTTTCTACAGATTACTACAAGTTCACATGCCCACAAGCCGATGAGATTGTGGTGCCCATACTAAAGAAGGCTATTGCAAAGGAACCACGCATAGCTGCTTCCCTTCTCAGGCTC
CTGTTTCATGACTGCTTTGTTCAG
GTTAGCACAGTTCAATTTCATTTCAATTTCATCCAGAATAAACAAAAGTCATCCGTCAGTCAGCCACCATGCATGGTTCACCCATGTGTTGGAAGT
TGAACATTGTTGAGTGCAAGAACCATGATTTCATGTTCTCTAGTCAATAATCTCAATTGTCTCGTGGTTTATGTAGTTATGTGATGAAATTGCAGGGATGTGATGCATCAGTTCTTTTGG
ATGACGCTGAGGAAGTTGTAAGTGAGAAAAAAGCTATTCCCAATAAGAATTCTATTAGGGGATTTGAGGTTATAGACGAGATCAAAGCTGCACTTGAGGAAGCATGTCCGAATACAGTGT
CTTGTGCTGACACTATCGCCCTAGCAGCCAGAGGTTCAACAGTACTG
GTAAATTTCTCTACATTCAAGTGACAAAAACCTGCACTAGTTACAGAAGAGAAAATATACAGGATTTCTCACA
AAAAATTGTTTTATTTTCTTTAATAAAAAGACTAAAAGCTGGTAGTCTCAAGCAAAATTTAATTAAGATTTTCCCTAAAAAACTTAATCTAGGTCCACTTGGTACATAATCAATATAATC
TTATCACCTGACAGAGTGGTGGACCATATTGGGAACTTCCATTAGGAAGGAGGGACTCAAAGACAGCAAACATGAAGCTAGCAAACAAGAACCTTCCTCCACCAAATGCAACACTACATC
GTCTTATCAAGTTCTTCCAAAGGCAAGGACTGGACAAGGTGGACCTTGTTGCATTATCAG
GTATAGTACTGGCACATCTTAATGCTCAAATTATTTTTTTTTCAAAAACACGTAGGGAAA
CCGAGTGTCATTGTATTGAGAAGATTGAAAACCCTTATACAAAAGGGCCACACAACGAAAAGGCACATGCACACACACACAACAACCAACACCTCTACTGATATATTCAATGCTAAAAAA
ACACTGATATGATATAAAATAGTTAATGGAATTGGTTCAGTTGTACAGAATGTCTTCGATTTTCCTTGTTATAAGCTTAGGGCTGAAAGTATAGCAAGAAAAACATTGTATAGGACATAG
TATAAATGCATCACTATCATCAGCAAGAATATCTGTTAGACAACAATGGAAAATAAATAGTATGTTGCTATTGGGTCTGCATATTCTTATCTTCCTAAAGAGTTTATTTTTACACTGACA
GGAAGCCACACCATTGGAAAGGCCAGATGTGTGAGTTTCAAACAACGACTCTACAATCAGCATAGAGATAACAGACCAGACAACACACTAGAAAAAAGTTTCTATCACACATTGGCATCG
GCGTGCCCACACACTGGTGGTGATGACAACATAAGGTCCCTAGATTTTGTCAGCCCTTCGCAATTTGACAACAGCTATTATAAGCTGATATTGGAGGGAAAAGGGCTCCTTAATTCAGAT
GAAGTTTTGTGGACAGGAAAAGACCCCGAAATAGCAGGTCTAGTAAAAAGTTATGCAGAAAACGAGCAACTATTCTTTGAACATTATGTGAATTCAATAATCAAAATGGGGAACATAAAT
CCCCTCATGGGTTACAATGGAGAAATCCGCAAGAACTGCCATAGGGTTAATCAGGATATCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAATCAATATAGTTCTTGGTGCAATTTTCATTGCTTCCTTCTACTTATCTGGCTCCCTTGCCTTCCCTCCTGGTCACGATGAGGGAGCCCATCCAATTGGAAATGGTCCAATC
TCAGGTCTTTCTACAGATTACTACAAGTTCACATGCCCACAAGCCGATGAGATTGTGGTGCCCATACTAAAGAAGGCTATTGCAAAGGAACCACGCATAGCTGCTTCCCTTCTCAGGCTC
CTGTTTCATGACTGCTTTGTTCAG
GGATGTGATGCATCAGTTCTTTTGGATGACGCTGAGGAAGTTGTAAGTGAGAAAAAAGCTATTCCCAATAAGAATTCTATTAGGGGATTTGAGGTT
ATAGACGAGATCAAAGCTGCACTTGAGGAAGCATGTCCGAATACAGTGTCTTGTGCTGACACTATCGCCCTAGCAGCCAGAGGTTCAACAGTACTG
AGTGGTGGACCATATTGGGAACTT
CCATTAGGAAGGAGGGACTCAAAGACAGCAAACATGAAGCTAGCAAACAAGAACCTTCCTCCACCAAATGCAACACTACATCGTCTTATCAAGTTCTTCCAAAGGCAAGGACTGGACAAG
GTGGACCTTGTTGCATTATCAG
GAAGCCACACCATTGGAAAGGCCAGATGTGTGAGTTTCAAACAACGACTCTACAATCAGCATAGAGATAACAGACCAGACAACACACTAGAAAAAAGT
TTCTATCACACATTGGCATCGGCGTGCCCACACACTGGTGGTGATGACAACATAAGGTCCCTAGATTTTGTCAGCCCTTCGCAATTTGACAACAGCTATTATAAGCTGATATTGGAGGGA
AAAGGGCTCCTTAATTCAGATGAAGTTTTGTGGACAGGAAAAGACCCCGAAATAGCAGGTCTAGTAAAAAGTTATGCAGAAAACGAGCAACTATTCTTTGAACATTATGTGAATTCAATA
ATCAAAATGGGGAACATAAATCCCCTCATGGGTTACAATGGAGAAATCCGCAAGAACTGCCATAGGGTTAATCAGGATATCTAG

Retrieve as FASTA