Entry information : MtPrx85 (Medtr4g122640.1[4.0] / Medtr4g122640.1[3.5] / Medtr8g136930.1)
Entry ID 2785
Creation 2006-06-27 (Christophe Dunand)
Last sequence changes 2013-12-31 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-25 (Catherine Mathe)
Peroxidase information: MtPrx85 (Medtr4g122640.1[4.0] / Medtr4g122640.1[3.5] / Medtr8g136930.1)
Name (synonym) MtPrx85 (Medtr4g122640.1[4.0] / Medtr4g122640.1[3.5] / Medtr8g136930.1)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Leaves
Inducers Pathogen interaction
Virus infection
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx85
start..stop
S start..stop
GmPrx164 557 0 7..336 4..332
GmPrx285 522 0 17..336 14..322
LjPrx40 513 0 27..336 25..333
VvPrx19 471 1e-168 1..336 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50574792..50575040 249 N° 2 50575287..50575478 192 N° 3 50575561..50575726 166 N° 4 50575837..50576240 404
join(50574792..50575040,50575287..50575478,50575561..50575726,50575837..50576240 )


exon

Literature and cross-references MtPrx85 (Medtr4g122640.1[4.0] / Medtr4g122640.1[3.5] / Medtr8g136930.1)
Literature Liu,J., Scott,A.D., May,G.D. and Nelson,R.S. Medicago truncatula Alfalfa Mosaic Virus- (AMV) Infected Leaves Expressed Sequence Tags from the Samuel Roberts Noble Foundation-Center for Medicago Genomics Research. Unpublished (2005).
Protein ref. UniProtKB_Uniparc:   Q1SWB6
DNA ref. Phytozome 12:   chr4 (50574792..50576240)
EST ref. GenBank:   BQ153608.1 [3' end]   CX517883 [Fragment]
Cluster/Prediction ref. Phytozome Gene 12:   31115018
Omic ref. Gene atlas:   Mtr.42373.1.S1_at Legoo:   Mtr.42373.1.S1_at
Protein sequence: MtPrx85 (Medtr4g122640.1[4.0] / Medtr4g122640.1[3.5] / Medtr8g136930.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (315)
PWM (Da):   %s   36051.81 (33821.6)  
PI (pH):   %s   4.54 (4.47) Peptide Signal:   %s   cut: 22 range:22-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMKLAILLCLVILNLTSAFAARVNDAYGGDTDTGSPLGTDIYQYSCPEAEAIIFSWVEQAVSSDPRMAASLLRLHFHDCFVNGCDASVLLDDTENFVGEKTAAPNVNSLRGFDVINEIKSELEVVCPQTVSCADILATAARDSVLLSGGPTWEVQMGRKDSITASKAGANNNIPGPNSTVDMLVAKFENVGLTLQDMVALSGAHTIGKARCSTFSSRLRSNSVSDGPYVNAEFVSSLKRLCSGQDNSNRIAHLDLVTPATFDNQYYINLLSGEGLLPSDQTLVNGNDQTRQIVETYVANPFVFFDDFKNSMVKMGSLGTATQSIGQIRRDCRTIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns) and 2 ESTs (BQ153608).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATGAAGTTAGCAATATTATTGTGTTTGGTGATACTCAACCTCACTTCAGCATTTGCAGCCAGAGTGAATGATGCCTATGGTGGTGATACAGATACTGGCAGTCCATTAGGGACT
GACATATACCAATACAGTTGCCCTGAAGCAGAGGCCATAATCTTCTCTTGGGTGGAACAAGCTGTCTCTAGTGACCCAAGAATGGCTGCTTCATTGCTAAGGCTACATTTTCATGATTGC
TTTGTCAAT
GCAAGCACTTCTTTGCCTTCATATATTGTCTTTTTTATTTTTATTTTTTAAATGGTCTAAACAAATTTTTATTACGTATAAATTTAAATTTAATTTCTATAAAATGTTTAG
CTCCTACCTTTTATACAAATAGATGTTTTTAGTCCCTACAACACACCCGTTTTTATAATAAGCCATGAACTAAAAGGTATAAATTGATAAAAAAAAATTATAGAAACTAAAATAAATGTA
AATCATTTTTTACAGGGTTGTGATGCTTCAGTCTTGCTGGATGACACAGAAAACTTTGTTGGTGAGAAAACAGCTGCTCCAAACGTGAATTCACTTAGAGGATTTGATGTAATCAATGAA
ATAAAATCTGAACTAGAAGTAGTTTGTCCACAAACTGTTTCTTGTGCTGACATACTAGCAACTGCTGCTCGAGATTCGGTTCTTCTG
GTTTGTCATTGCTCCTTTGGATTCGAATTTGAT
CCTTCTTATTTTATTTTATTTTTCTAAATTAGTATTATTTCTATTATAGTCAGGAGGACCAACTTGGGAGGTGCAAATGGGAAGAAAAGATAGTATAACGGCTAGCAAGGCAGGAGCAAA
TAATAACATTCCGGGACCAAACTCAACAGTTGATATGCTTGTGGCCAAGTTTGAAAACGTAGGCCTTACACTTCAAGACATGGTTGCCCTCTCAG
GTTAATCCTCTGGATATTGTTATTT
CCGTGTTAACGTACAGATAATTTACTCAGTTCATTGAAAATCAAGATTAGTGTTGCTTATTTTATTTTTTTTACCCTCTTTTCAGGTGCACATACAATAGGAAAAGCCCGCTGCTCAACA
TTTAGCTCTCGCTTACGAAGTAACAGCGTCTCAGACGGTCCATATGTTAATGCTGAATTTGTATCATCATTGAAGCGGTTGTGCTCGGGGCAAGATAATAGCAACCGAATTGCACATCTT
GACCTGGTCACACCAGCAACATTTGATAATCAATACTATATCAATCTTCTATCTGGGGAAGGATTGCTTCCATCGGACCAAACTTTGGTGAATGGGAATGATCAGACACGACAGATTGTC
GAAACCTATGTAGCAAATCCGTTTGTTTTCTTTGATGACTTCAAGAATTCAATGGTGAAAATGGGAAGCTTGGGAACAGCTACACAGAGCATCGGGCAGATTCGCAGAGACTGCCGAACT
ATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATGAAGTTAGCAATATTATTGTGTTTGGTGATACTCAACCTCACTTCAGCATTTGCAGCCAGAGTGAATGATGCCTATGGTGGTGATACAGATACTGGCAGTCCATTAGGGACT
GACATATACCAATACAGTTGCCCTGAAGCAGAGGCCATAATCTTCTCTTGGGTGGAACAAGCTGTCTCTAGTGACCCAAGAATGGCTGCTTCATTGCTAAGGCTACATTTTCATGATTGC
TTTGTCAAT
GGTTGTGATGCTTCAGTCTTGCTGGATGACACAGAAAACTTTGTTGGTGAGAAAACAGCTGCTCCAAACGTGAATTCACTTAGAGGATTTGATGTAATCAATGAAATAAAA
TCTGAACTAGAAGTAGTTTGTCCACAAACTGTTTCTTGTGCTGACATACTAGCAACTGCTGCTCGAGATTCGGTTCTTCTG
TCAGGAGGACCAACTTGGGAGGTGCAAATGGGAAGAAAA
GATAGTATAACGGCTAGCAAGGCAGGAGCAAATAATAACATTCCGGGACCAAACTCAACAGTTGATATGCTTGTGGCCAAGTTTGAAAACGTAGGCCTTACACTTCAAGACATGGTTGCC
CTCTCAG
GTGCACATACAATAGGAAAAGCCCGCTGCTCAACATTTAGCTCTCGCTTACGAAGTAACAGCGTCTCAGACGGTCCATATGTTAATGCTGAATTTGTATCATCATTGAAGCGG
TTGTGCTCGGGGCAAGATAATAGCAACCGAATTGCACATCTTGACCTGGTCACACCAGCAACATTTGATAATCAATACTATATCAATCTTCTATCTGGGGAAGGATTGCTTCCATCGGAC
CAAACTTTGGTGAATGGGAATGATCAGACACGACAGATTGTCGAAACCTATGTAGCAAATCCGTTTGTTTTCTTTGATGACTTCAAGAATTCAATGGTGAAAATGGGAAGCTTGGGAACA
GCTACACAGAGCATCGGGCAGATTCGCAGAGACTGCCGAACTATTAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATGA AGTTAGCAAT ATTATTGTGT TTGGTGATAC TCAACCTCAC TTCAGCATTT GCAGCCAGAG TGAATGATGC CTATGGTGGT GATACAGATA CTGGCAGTCC ATTAGGGACT  GACATATACC AATACAGTTG CCCTGAAGCA GAGGCCATAA TCTTCTCTTG GGTGGAACAA GCTGTCTCTA GTGACCCAAG AATGGCTGCT TCATTGCTAA GGCTACATTT TCATGATTGC  TTTGTCAATG GTTGTGATGC TTCAGTCTTG CTGGATGACA CAGAAAACTT TGTTGGTGAG AAAACAGCTG CTCCAAACGT GAATTCACTT AGAGGATTTG ATGTAATCAA TGAAATAAAA  TCTGAACTAG AAGTAGTTTG TCCACAAACT GTTTCTTGTG CTGACATACT AGCAACTGCT GCTCGAGATT CGGTTCTTCT GTCAGGAGGA CCAACTTGGG AGGTGCAAAT GGGAAGAAAA  GATAGTATAA CGGCTAGCAA GGCAGGAGCA AATAATAACA TTCCGGGACC AAACTCAACA GTTGATATGC TTGTGGCCAA GTTTGAAAAC GTAGGCCTTA CACTTCAAGA CATGGTTGCC  CTCTCAGGTG CACATACAAT AGGAAAAGCC CGCTGCTCAA CATTTAGCTC TCGCTTACGA AGTAACAGCG TCTCAGACGG TCCATATGTT AATGCTGAAT TTGTATCATC ATTGAAGCGG  TTGTGCTCGG GGCAAGATAA TAGCAACCGA ATTGCACATC TTGACCTGGT CACACCAGCA ACATTTGATA ATCAATACTA TATCAATCTT CTATCTGGGG AAGGATTGCT TCCATCGGAC  CAAACTTTGG TGAATGGGAA TGATCAGACA CGACAGATTG TCGAAACCTA TGTAGCAAAT CCGTTTGTTT TCTTTGATGA CTTCAAGAAT TCAATGGTGA AAATGGGAAG CTTGGGAACA  GCTACACAGA GCATCGGGCA GATTCGCAGA GACTGCCGAA CTATTAATTA AATAATTTAA GTCAAGTTGA TAATGCCCTA TGTAAACTCA GTATGATGGT CGTGTGCTAT TCCATCGTTA 
GGAAAAATTA TGTTAAGTGT GTGGGATGAA AACGTACTGA TTAATTAATT AATGATTACT TGAATCGAGC TGAGTAGCTC TTTAT 

Retrieve as FASTA