Entry information : CgCcP (ChaetomCcP)
Entry ID 2808
Creation 2006-11-07 (Marcel Zamocky)
Last sequence changes 2012-04-24 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2012-04-24 (Catherine Mathe (Scipio))
Peroxidase information: CgCcP (ChaetomCcP)
Name (synonym) CgCcP (ChaetomCcP)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium globosum    [TaxId: 38033 ]
Cellular localisation Mitochondria
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgCcP
start..stop
S start..stop
StheCcP 625 0 1..355 1..355
TterCcP01 617 0 1..355 1..357
NcCcP 604 0 3..355 6..358
CtheCcP01 604 0 1..353 1..353
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4833458..4833938 481 N° 2 4833027..4833400 374 N° 3 4832754..4832966 213  
complement(join(4832754..4832966,4833027..4833400,4833458..4833938))


exon

Literature and cross-references CgCcP (ChaetomCcP)
Literature Lander E., Birren B. The Genome Sequencing Platform, The Genome Assembly Team Broad Institute of MIT and Harvard
Protein ref. UniProtKB:   Q2HDY7
DNA ref. JGI genome:   scaffold_1 (4833938..4832754)
mRNA ref. GenBank:   XM_001220787
Protein sequence: CgCcP (ChaetomCcP)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 355
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
39520.69  
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
9.13
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTATRTFTRALRTSARPAFTAAPRAAFRQGGRRYYSSEPAAKQSSSTWLWVAGAAAVGGGGWFFLNNQGSATPKVFTPKFEDYQAVYNEIANRLEENDEYDDGSYGPVLVRLAWHASGTYDAATGTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKKKFPWITYSDLWILAGVCSIQEMLGPKIPFRAGRQDKDVAACTPDGRLPDAAQAQDHLRNIFYRMGFNDQEIVALAGAHALGRCHSNRSGYEGPWTFSPTVLTNDFYKLLLDEKWQWKKWNGPKYEDKKTKSLMMLPADMALVEDKKFKNWVKEYAADNDLFFKDFSAVVTKLFELGVPFKEGTEKWVFKTVNA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and cDNA. Strain="CBS 148.51".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGACCGCAACTCGCACTTTCACCCGCGCTCTGCGCACCTCAGCTCGGCCTGCGTTCACCGCTGCGCCCCGGGCCGCTTTCCGCCAGGGTGGCCGCCGCTACTACTCGTCGGAGCCC
GCCGCGAAGCAGAGTTCGTCGACCTGGCTCTGGGTTGCCGGTGCTGCCGCTGTCGGAGGTGGTGGCTGGTTCTTCCTGAACAACCAGGGCTCGGCCACGCCCAAGGTCTTCACCCCCAAA
TTCGAGGACTACCAAGCCGTGTACAACGAGATCGCCAACCGTTTGGAGGAGAACGACGAGTACGACGACGGCAGCTATGGCCCCGTTCTGGTTCGCCTCGCTTGGCACGCCAGCGGCACC
TATGATGCCGCCACCGGTACCGGCGGCAGCAACGGCGCCACCATGCGCTTCGCCCCCGAGAGCGACCACGGTGCCAACGCCGGTCTGAAGGCCGCTCGGGACTTCCTCGAGCCTGTGAAG
A
GTAAGTCTTGTAGGGTATAGGGTATCGGGAGTGCCCGGTGGCTGACAATGGAAACAGAGAAGTTCCCCTGGATCACCTACTCTGATCTCTGGATCCTCGCTGGTGTCTGCTCCATCCAG
GAGATGCTCGGCCCCAAGATCCCCTTCCGCGCCGGTCGCCAGGACAAGGACGTTGCTGCCTGCACCCCCGACGGCCGCCTGCCTGACGCCGCCCAGGCCCAAGACCACCTCCGCAACATC
TTCTACCGCATGGGCTTCAACGACCAGGAGATCGTTGCCCTGGCTGGTGCCCACGCCCTCGGCCGGTGCCACTCCAACCGCTCCGGCTACGAGGGCCCCTGGACCTTCTCCCCTACCGTC
CTGACCAACGACTTCTACAAGCTTCTCCTTGACGAGAAGTGGCAGTGGAAGAAGTGGAATGGCCCTAAGCAG
GTAAGCCGAGCCGGCAACTCTCGCAATGATTTCGGGAACGGCTGCTGA
CGCAAGAAATAGTACGAGGACAAGAAGACCAAGTCGCTCATGATGCTGCCGGCCGACATGGCGCTGGTCGAGGACAAGAAGTTCAAGAACTGGGTCAAGGAGTACGCCGCCGACAACGAC
CTCTTCTTCAAGGACTTCTCGGCCGTCGTCACCAAGCTCTTTGAGCTGGGCGTACCCTTCAAGGAGGGCACCGAGAAGTGGGTGTTCAAGACCGTCAACGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGACCGCAACTCGCACTTTCACCCGCGCTCTGCGCACCTCAGCTCGGCCTGCGTTCACCGCTGCGCCCCGGGCCGCTTTCCGCCAGGGTGGCCGCCGCTACTACTCGTCGGAGCCC
GCCGCGAAGCAGAGTTCGTCGACCTGGCTCTGGGTTGCCGGTGCTGCCGCTGTCGGAGGTGGTGGCTGGTTCTTCCTGAACAACCAGGGCTCGGCCACGCCCAAGGTCTTCACCCCCAAA
TTCGAGGACTACCAAGCCGTGTACAACGAGATCGCCAACCGTTTGGAGGAGAACGACGAGTACGACGACGGCAGCTATGGCCCCGTTCTGGTTCGCCTCGCTTGGCACGCCAGCGGCACC
TATGATGCCGCCACCGGTACCGGCGGCAGCAACGGCGCCACCATGCGCTTCGCCCCCGAGAGCGACCACGGTGCCAACGCCGGTCTGAAGGCCGCTCGGGACTTCCTCGAGCCTGTGAAG
A
AGAAGTTCCCCTGGATCACCTACTCTGATCTCTGGATCCTCGCTGGTGTCTGCTCCATCCAGGAGATGCTCGGCCCCAAGATCCCCTTCCGCGCCGGTCGCCAGGACAAGGACGTTGCT
GCCTGCACCCCCGACGGCCGCCTGCCTGACGCCGCCCAGGCCCAAGACCACCTCCGCAACATCTTCTACCGCATGGGCTTCAACGACCAGGAGATCGTTGCCCTGGCTGGTGCCCACGCC
CTCGGCCGGTGCCACTCCAACCGCTCCGGCTACGAGGGCCCCTGGACCTTCTCCCCTACCGTCCTGACCAACGACTTCTACAAGCTTCTCCTTGACGAGAAGTGGCAGTGGAAGAAGTGG
AATGGCCCTAAGCAG
TACGAGGACAAGAAGACCAAGTCGCTCATGATGCTGCCGGCCGACATGGCGCTGGTCGAGGACAAGAAGTTCAAGAACTGGGTCAAGGAGTACGCCGCCGACAAC
GACCTCTTCTTCAAGGACTTCTCGGCCGTCGTCACCAAGCTCTTTGAGCTGGGCGTACCCTTCAAGGAGGGCACCGAGAAGTGGGTGTTCAAGACCGTCAACGCCTAA

Retrieve as FASTA