Entry information : CgCcP (ChaetomCcP)
Entry ID 2808
Creation 2006-11-07 (Marcel Zamocky)
Last sequence changes 2012-04-24 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2012-04-24 (Catherine Mathe (Scipio))
Peroxidase information: CgCcP (ChaetomCcP)
Name (synonym) CgCcP (ChaetomCcP)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium globosum    [TaxId: 38033 ]
Cellular localisation Mitochondria
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgCcP
start..stop
S start..stop
StheCcP 625 0 1..355 1..355
TterCcP01 617 0 1..355 1..357
NcCcP 604 0 3..355 6..358
CtheCcP01 604 0 1..353 1..353
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4833458..4833938 481 N° 2 4833027..4833400 374 N° 3 4832754..4832966 213  
complement(join(4832754..4832966,4833027..4833400,4833458..4833938))


exon

Literature and cross-references CgCcP (ChaetomCcP)
Literature Lander E., Birren B. The Genome Sequencing Platform, The Genome Assembly Team Broad Institute of MIT and Harvard
Protein ref. UniProtKB:   Q2HDY7
DNA ref. JGI genome:   scaffold_1 (4833938..4832754)
mRNA ref. GenBank:   XM_001220787
Protein sequence: CgCcP (ChaetomCcP)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355
PWM (Da):   %s   39520.69  
PI (pH):   %s   9.13
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTATRTFTRALRTSARPAFTAAPRAAFRQGGRRYYSSEPAAKQSSSTWLWVAGAAAVGGGGWFFLNNQGSATPKVFTPKFEDYQAVYNEIANRLEENDEYDDGSYGPVLVRLAWHASGTYDAATGTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKKKFPWITYSDLWILAGVCSIQEMLGPKIPFRAGRQDKDVAACTPDGRLPDAAQAQDHLRNIFYRMGFNDQEIVALAGAHALGRCHSNRSGYEGPWTFSPTVLTNDFYKLLLDEKWQWKKWNGPKYEDKKTKSLMMLPADMALVEDKKFKNWVKEYAADNDLFFKDFSAVVTKLFELGVPFKEGTEKWVFKTVNA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and cDNA. Strain="CBS 148.51".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGACCGCAACTCGCACTTTCACCCGCGCTCTGCGCACCTCAGCTCGGCCTGCGTTCACCGCTGCGCCCCGGGCCGCTTTCCGCCAGGGTGGCCGCCGCTACTACTCGTCGGAGCCC
GCCGCGAAGCAGAGTTCGTCGACCTGGCTCTGGGTTGCCGGTGCTGCCGCTGTCGGAGGTGGTGGCTGGTTCTTCCTGAACAACCAGGGCTCGGCCACGCCCAAGGTCTTCACCCCCAAA
TTCGAGGACTACCAAGCCGTGTACAACGAGATCGCCAACCGTTTGGAGGAGAACGACGAGTACGACGACGGCAGCTATGGCCCCGTTCTGGTTCGCCTCGCTTGGCACGCCAGCGGCACC
TATGATGCCGCCACCGGTACCGGCGGCAGCAACGGCGCCACCATGCGCTTCGCCCCCGAGAGCGACCACGGTGCCAACGCCGGTCTGAAGGCCGCTCGGGACTTCCTCGAGCCTGTGAAG
A
GTAAGTCTTGTAGGGTATAGGGTATCGGGAGTGCCCGGTGGCTGACAATGGAAACAGAGAAGTTCCCCTGGATCACCTACTCTGATCTCTGGATCCTCGCTGGTGTCTGCTCCATCCAG
GAGATGCTCGGCCCCAAGATCCCCTTCCGCGCCGGTCGCCAGGACAAGGACGTTGCTGCCTGCACCCCCGACGGCCGCCTGCCTGACGCCGCCCAGGCCCAAGACCACCTCCGCAACATC
TTCTACCGCATGGGCTTCAACGACCAGGAGATCGTTGCCCTGGCTGGTGCCCACGCCCTCGGCCGGTGCCACTCCAACCGCTCCGGCTACGAGGGCCCCTGGACCTTCTCCCCTACCGTC
CTGACCAACGACTTCTACAAGCTTCTCCTTGACGAGAAGTGGCAGTGGAAGAAGTGGAATGGCCCTAAGCAG
GTAAGCCGAGCCGGCAACTCTCGCAATGATTTCGGGAACGGCTGCTGA
CGCAAGAAATAGTACGAGGACAAGAAGACCAAGTCGCTCATGATGCTGCCGGCCGACATGGCGCTGGTCGAGGACAAGAAGTTCAAGAACTGGGTCAAGGAGTACGCCGCCGACAACGAC
CTCTTCTTCAAGGACTTCTCGGCCGTCGTCACCAAGCTCTTTGAGCTGGGCGTACCCTTCAAGGAGGGCACCGAGAAGTGGGTGTTCAAGACCGTCAACGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGACCGCAACTCGCACTTTCACCCGCGCTCTGCGCACCTCAGCTCGGCCTGCGTTCACCGCTGCGCCCCGGGCCGCTTTCCGCCAGGGTGGCCGCCGCTACTACTCGTCGGAGCCC
GCCGCGAAGCAGAGTTCGTCGACCTGGCTCTGGGTTGCCGGTGCTGCCGCTGTCGGAGGTGGTGGCTGGTTCTTCCTGAACAACCAGGGCTCGGCCACGCCCAAGGTCTTCACCCCCAAA
TTCGAGGACTACCAAGCCGTGTACAACGAGATCGCCAACCGTTTGGAGGAGAACGACGAGTACGACGACGGCAGCTATGGCCCCGTTCTGGTTCGCCTCGCTTGGCACGCCAGCGGCACC
TATGATGCCGCCACCGGTACCGGCGGCAGCAACGGCGCCACCATGCGCTTCGCCCCCGAGAGCGACCACGGTGCCAACGCCGGTCTGAAGGCCGCTCGGGACTTCCTCGAGCCTGTGAAG
A
AGAAGTTCCCCTGGATCACCTACTCTGATCTCTGGATCCTCGCTGGTGTCTGCTCCATCCAGGAGATGCTCGGCCCCAAGATCCCCTTCCGCGCCGGTCGCCAGGACAAGGACGTTGCT
GCCTGCACCCCCGACGGCCGCCTGCCTGACGCCGCCCAGGCCCAAGACCACCTCCGCAACATCTTCTACCGCATGGGCTTCAACGACCAGGAGATCGTTGCCCTGGCTGGTGCCCACGCC
CTCGGCCGGTGCCACTCCAACCGCTCCGGCTACGAGGGCCCCTGGACCTTCTCCCCTACCGTCCTGACCAACGACTTCTACAAGCTTCTCCTTGACGAGAAGTGGCAGTGGAAGAAGTGG
AATGGCCCTAAGCAG
TACGAGGACAAGAAGACCAAGTCGCTCATGATGCTGCCGGCCGACATGGCGCTGGTCGAGGACAAGAAGTTCAAGAACTGGGTCAAGGAGTACGCCGCCGACAAC
GACCTCTTCTTCAAGGACTTCTCGGCCGTCGTCACCAAGCTCTTTGAGCTGGGCGTACCCTTCAAGGAGGGCACCGAGAAGTGGGTGTTCAAGACCGTCAACGCCTAA

Retrieve as FASTA