Entry information : PcCcP (PhaneroCcP)
Entry ID 2821
Creation 2006-02-23 (Marcel Zamocky)
Last sequence changes 2011-12-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-28 (Catherine Mathe (Scipio))
Peroxidase information: PcCcP (PhaneroCcP)
Name (synonym) PcCcP (PhaneroCcP)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation Mitochondria
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcCcP
start..stop
S start..stop
PcarCcP 622 0 1..380 1..377
PgigCcP 554 0 1..383 1..386
BaCcP 551 0 1..380 1..385
CsuCcP 538 0 1..377 1..378
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 489414..489722 309 N° 2 489779..489833 55 N° 3 489889..489970 82 N° 4 490026..490613 588
N° 5 490672..490807 136  
join(489414..489722,489779..489833,489889..489970,490026..490613,490672..490807)


exon

Literature and cross-references PcCcP (PhaneroCcP)
Literature Martinez,D.,Larrondo,L.F., Putnam,N., Sollewijn Gelpke,M.D.,Huang,K., REFERENCE 1 Chapman,J.,Helfenbein,K.G., Ramaiya,P., Detter,J.C.,
Larimer,F.,Coutinho,P.M., Henrissat,B., Berka,R., Cullen,D. and Rokhsar,D. Genome sequence of the lignocellulose degrading fungus Phanerochaete chrysosporium strain RP78. Nat. Biotechnol. 22 (6), 695-700 (2004)
REFERENCE 2 Zamocky M. Divergent evolutionary lines of cytochrome c peroxidases (2006 in preparation)
DNA ref. JGI genome:   scaffold_6 (489414..490807)
Cluster/Prediction ref. JGI gene:   123914
Protein sequence: PcCcP (PhaneroCcP)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   389
PWM (Da):   %s   42959.36  
PI (pH):   %s   7.08
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFAALRASLRRAAAPAPAALRRSAIRSSVRRYSTEPPPPPPPPKSHTALYAGLGVAALGGVAFWVYTSDSEAAKSAGSAVRSGVQGAKAATKFTPTKEDYIKVYNKIAEVMDEASDKDYDDGSYGPIFLRLGWHSSGTYDKETNTGGSNFATMRFAPESEHKANKGLHVARDLMEEIHKEFPWISYGDLWTLGAVTAIQEMGGPHVPWRPGRIDGYAAQATPDGRLPDGAQGADHLRQIFGRMGFDDREIVALSGGHAVGRCHRAWSGWDGPWTFSPITMSNSFFKLLFDEKWVLKKWDGPKQFEDKGTRSLMMLPTDYVLVQDKSFRKWARAYADDEELFFKDFAAVCVKLFENGVPEHQWATSEPWIMPTLDEQKEALEAKEAKSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). No EST. Strain="RP-78".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCGCTGCCCTCCGTGCTTCGCTTCGGCGGGCTGCTGCCCCCGCTCCTGCCGCCCTTAGGCGTTCTGCCATCCGCTCTAGCGTGCGCAGGTACTCGACCGAACCCCCGCCCCCT
CCTCCCCCTCCCAAGTCGCACACGGCGCTCTATGCTGGCCTTGGAGTTGCTGCTCTCGGAGGTGTCGCCTTCTGGGTCTACACCTCCGACAGCGAAGCTGCGAAATCTGCGGGCTCTGCA
GTCCGGTCGGGCGTGCAAGGCGCAAAGGCTGCGACCAAATTCACGCCTACAAAGGAGGATTACATCAAG
GTATGCCTTTATGCCAACTAGTACAGCCTTCGGAGGTACTGAAGGCCCGCC
CTCAGGTGTACAATAAAATTGCAGAAGTCATGGACGAGGCCTCCGATAAGGACTACGATGGTGAGCATAGCGAGGACGCGTAGGCCCGTTCCGGGGCGCTCACGGTGGTAATTAGATGGC
TCTTACGGCCCTATCTTCCTGCGTCTCGGATGGCACTCGTCCGGCACGTACGACAAGGAGACCAACACGGGCGGCAG
GTACGCTTATCTCCCCCGCTCATGTAGCCAGGAACATGCATTG
ACCTGCCTGCAGCAACTTCGCCACCATGCGCTTCGCCCCCGAGTCCGAGCACAAGGCCAATAAGGGCCTGCATGTTGCGCGCGACCTGATGGAGGAGATCCACAAGGAGTTCCCCTGGAT
CTCCTACGGCGACCTTTGGACACTCGGCGCGGTGACTGCCATCCAGGAGATGGGCGGCCCGCACGTGCCCTGGAGACCGGGACGCATCGACGGCTACGCGGCGCAGGCGACGCCCGACGG
GCGGCTTCCCGACGGCGCGCAGGGCGCAGATCACCTCCGTCAGATCTTCGGGCGCATGGGTTTCGACGACCGCGAGATCGTCGCGCTCTCGGGCGGGCACGCCGTTGGTCGCTGCCACCG
CGCGTGGAGCGGCTGGGACGGTCCCTGGACGTTCTCGCCGATCACGATGAGCAACTCGTTCTTCAAACTGCTCTTCGATGAGAAGTGGGTCCTCAAGAAGTGGGACGGCCCGAAGCAGTT
TGAGGACAAGGGCACGCGCTCGCTCATGATGCTCCCCACCGACTACGTGCTTGTTCAGGACAAGAGCTTCAGGAAGTGGGCGCGCGCGTACGCGGACGACGAGGAGCTGTTCTTCAAAGA
GTGAGGGTTGCCCTTCGTGCATATTCCAGTTTGTAATACTCATTGCGCTTTCCCCTAGCTTCGCCGCCGTCTGCGTCAAGTTATTCGAAAATGGTGTCCCTGAGCATCAGTGGGCAACTT
CCGAGCCATGGATTATGCCAACGCTCGACGAGCAGAAGGAAGCCCTAGAAGCTAAGGAGGCGAAGTCGTCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCGCTGCCCTCCGTGCTTCGCTTCGGCGGGCTGCTGCCCCCGCTCCTGCCGCCCTTAGGCGTTCTGCCATCCGCTCTAGCGTGCGCAGGTACTCGACCGAACCCCCGCCCCCT
CCTCCCCCTCCCAAGTCGCACACGGCGCTCTATGCTGGCCTTGGAGTTGCTGCTCTCGGAGGTGTCGCCTTCTGGGTCTACACCTCCGACAGCGAAGCTGCGAAATCTGCGGGCTCTGCA
GTCCGGTCGGGCGTGCAAGGCGCAAAGGCTGCGACCAAATTCACGCCTACAAAGGAGGATTACATCAAG
GTGTACAATAAAATTGCAGAAGTCATGGACGAGGCCTCCGATAAGGACTAC
GATG
ATGGCTCTTACGGCCCTATCTTCCTGCGTCTCGGATGGCACTCGTCCGGCACGTACGACAAGGAGACCAACACGGGCGGCAGCAACTTCGCCACCATGCGCTTCGCCCCCGAGTCC
GAGCACAAGGCCAATAAGGGCCTGCATGTTGCGCGCGACCTGATGGAGGAGATCCACAAGGAGTTCCCCTGGATCTCCTACGGCGACCTTTGGACACTCGGCGCGGTGACTGCCATCCAG
GAGATGGGCGGCCCGCACGTGCCCTGGAGACCGGGACGCATCGACGGCTACGCGGCGCAGGCGACGCCCGACGGGCGGCTTCCCGACGGCGCGCAGGGCGCAGATCACCTCCGTCAGATC
TTCGGGCGCATGGGTTTCGACGACCGCGAGATCGTCGCGCTCTCGGGCGGGCACGCCGTTGGTCGCTGCCACCGCGCGTGGAGCGGCTGGGACGGTCCCTGGACGTTCTCGCCGATCACG
ATGAGCAACTCGTTCTTCAAACTGCTCTTCGATGAGAAGTGGGTCCTCAAGAAGTGGGACGGCCCGAAGCAGTTTGAGGACAAGGGCACGCGCTCGCTCATGATGCTCCCCACCGACTAC
GTGCTTGTTCAGGACAAGAGCTTCAGGAAGTGGGCGCGCGCGTACGCGGACGACGAGGAGCTGTTCTTCAAAGA
CTTCGCCGCCGTCTGCGTCAAGTTATTCGAAAATGGTGTCCCTGAG
CATCAGTGGGCAACTTCCGAGCCATGGATTATGCCAACGCTCGACGAGCAGAAGGAAGCCCTAGAAGCTAAGGAGGCGAAGTCGTCGTAG

Retrieve as FASTA