Entry information : PtAPx04 (POPTR_0009s13650 / Potri.009G134100)
Entry ID 2875
Creation 2006-04-04 (Felipe Teixeira)
Last sequence changes 2006-04-04 (Felipe Teixeira)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: PtAPx04 (POPTR_0009s13650 / Potri.009G134100)
Name (synonym) PtAPx04 (POPTR_0009s13650 / Potri.009G134100)
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation Peroxisomal
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtAPx04
start..stop
S start..stop
PbAPx05 589 0 1..286 1..286
PtAPx06 521 0 1..285 1..285
PtoAPx01 519 0 1..285 1..285
LsaAPx02 497 1e-180 1..286 1..285
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10833965..10834077 113 N° 2 10833748..10833872 125 N° 3 10833616..10833665 50 N° 4 10832578..10832643 66
N° 5 10832450..10832498 49 N° 6 10830887..10830969 83 N° 7 10830711..10830790 80 N° 8 10830520..10830622 103
N° 9 10829839..10830030 192  
complement(join(10829839..10830030,10830520..10830622,10830711..10830790,1083088 7..10830969,10832450..10832498,10832578..10832643,10833616..10833665,10833748..1 0833872,10833965..10834077))


exon

Literature and cross-references PtAPx04 (POPTR_0009s13650 / Potri.009G134100)
Literature JGI
DNA ref. Phytozome 11:   scaffold_9 (10834077..10829839)
Cluster/Prediction ref. JGI gene:   557084 UniGene:   Pth.1428
Omic ref. ePlant:   Potri.009G134100
Protein sequence: PtAPx04 (POPTR_0009s13650 / Potri.009G134100)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   286
PWM (Da):   %s   31297 Transmb domain:   %s   o257-279i
PI (pH):   %s   7.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALPVVDTEYLKEIDKARRDLRALIAYKSCAPLMLRLAWHDAGTYDKNSKTGGANGSIRNEEEYSHGSNSGLKIAIDFEGVKAKHPKITYADLYLAGVVAVEVTGGPTIDFVPGRRDSNICPKEGRLPNAKLGSPHLRDIFYRMGLSDKDIVALSGGHTGRAHPDRSGFEGPWTQEPLKFDNSYFVEMLKGETDGLLKLPTDTALLDDPAFRPYVELYADEEAFFRDYAASHKKLSELGFTQGSSGFKVKDTTVLAQSAAGVAVAAAVVILSYFYEVRKKMK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns) and ESTs. Unigene contains ESTs from PtAPx04 and PtAPx06.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTACCGGTCGTTGACACAGAGTACCTGAAAGAGATCGACAAAGCACGTCGCGATCTCCGTGCTCTCATCGCTTACAAAAGCTGCGCTCCTCTCATGCTTCGCTTAGCGTAACTA
ACCAACTAACTAACCACTCATTGTCTTTGTTTGAATCTTTCTGTTTCGATTGATTTTTTATTTTCCGGTTATGGTTTTTTTGAAGGTGGCATGATGCAGGAACGTATGATAAGAACTCGA
AAACAGGAGGAGCTAATGGTTCGATAAGGAATGAAGAAGAGTACTCTCATGGTTCTAATAGTGGCTTGAAAATAGCTATCGATTTTTGCG
GTTAGTTAGTTCCACTGAAATTTAACTCAC
TTGATTTGTTGATTTTTTTTAAATATTTGATTATGATTTTTTAATTTTTTAGAGGGAGTGAAGGCGAAACATCCGAAGATTACTTATGCGGATTTATACCAGGTGATTTTCTTTGATTAA
TTGATGAATTGTATAATTAATGATGCAGATAATTAAATACCTGTTTAATTAATAATAGTATTTTCCATTTTTATGTCTATTTAATATGTTGTTTCACAGATTTGGTAGTTAATAATTAAC
ATTTATCTTGATTTTCTTGTCAAAAAATAACATATGTGGATATGTAACTGAAAAACTTGTGATTATAATGTAAATGAGGTAGCGATTTTTCGTGTGGGTGAGTGGAGAGGTGGAACATGC
ATGGAATATTCCAAGGATCACACACCACACACGCACACGTGTCCAGGAACGCACGCTCATTTTCCTGGGGAATGGAAAAACTAACTATATAGTTTGTGGATAGAGATGCAAGTTCTTAGG
ACGTTACAACCACTGACACGACTAAATCACAAGGCTTGAAGTTTTAAAATGTGTCTGCCTGACCTGTCTAGTCAATCTTCTCAATAATTTTACGTTAATTGCAATGAAATGACGAGTTCT
ATTAATGCAAGTATAGTGTATAGTGTTCCTGTCTCGTTGTCATCCATGTTGGTATCGAGCGCTCACGAATATTGATACCAACGGTGTCCTTTTAATTGATGAATAGGTTTCTAAGTTTTG
CAGGGAAGAATTTGGAGAGATTTTCTTCTAGTATTTTATCCTACCTATATAGGAGGAATTTGTTGATGGATATTGGGAGGTGGACACTATCAGATGTACTATCATGGATTCACGGTTGCA
GCTCTGATCCTTGGCAGGATACCCAACTATATTTGCCAAACTATGAACACACCAGCAAACCTTAAATTCCATGATTGTTACATCAGTCGGTACATTCAGTTCAAAATGAGTGTAGTTGTT
GATATACAATGAGTGGTGGTTTGAATATGAAATATTTGAATATTCTGAGTATAATTGTTGGGTTTCCAAACACAATGAGCAATTTGATTCATAGTCAACAACATTCATGTTCAGCTTGCA
GGTGTTGTTGCAGTGGAGGTCACTGGGGGTCCAACCATTGATTTTGTTCCTGGTAGAAGG
GTATGTGATTGTGGCATTTCTCGGCGATATAGGTGATTATGAGTTCATAACAATGCTGAC
TATATGTCCGATCTCTTAGGATTCAAATATTTGTCCCAAGGAAGGGCGACTTCCAAATGCTAAACTAGGTATTTTCAGTATTTTAATTATTGTGGAAACTTCTTTAATTTAATTCAGGGG
CTGGAAATTCTCAAATCGTTGTTTGCTTTCTTCTAATGTCATAAACTTAGCTAAACCTGATTCAAAGGGAAGGTGAATTTATGTGTTTTGTTGTGTCTTTGTCATTCTGTAAATAAGCCA
TCCATTGCATGTTTACAGTATCAAGAGAACTAATAGTTAAGGGGGTATGCGCTGTACAGGACTGATGCGCAGCAGACTAGTTTCGCTGGCTATAATTATCCATTGAATTTAGCTGTCTTC
AAGTAGTCTTCTCAGTCTATTGAATTTCTATTTCAAAAATCTAGTTTTCCAATTTTTGAGAACTTATGTTCCATGTGGACCTGAAAGTTCTTTCCTTAACGTGGGTATTGTGTTGAACAC
GAGTTGAAATGTTAGCCAGGATTGTAAATTGTTATGGTGTTTGGCTAAGAGGCAGAACCATCACACAAAATGCAAAGCAAGTTCATTTTGGGGACCCAATGCATTTGTTTACTCTAAGCA
TTGCACATGAAGATACATGCTAGATTTTCAGGCAAGATTATTTGTAGGTGAATCACTTATAATTGCTTGTTTGTTGGTTTCAGAACCTTTTGTATGTTCTGTCTCATAAAATTACTCCTA
AATCCATAGAGTTCTACCATTAGTAGGTGGTTTAACGTGGAGGAGTGTCAGGTTCTCGTATCTCAATTCATGCGATGATCTTTACTTGCGTTGGTTCTGCTGATAGAGCAGTCATACTGA
TCTGTTCTTTCATCTCATAACGCGCATATATTCGTGCTGATTTCTGTGTAAGAAATTTGTGTGTAAGTTGTAATTTGCAGGTGTTCTATGACTAAAAAATTGATGTTGTTTGATCTTCGT
ATGGGCTGTTTATTCAGACTTTCAGCATAGGAAGGGGCGAAGCTACACATTAGGGAAGGGGGGCAATTGCACCCCTTAATTTGTCATAATTATCACTTTAGTCCTTATACTTTCAATTTT
GTTTGATATTTTTAAATAAAAATACATTAGTTGCCCAACATAATTTTCCTAATTCTTAACTATGAAACCCCTTTAATTTTTTATACTTCCCACTTTAATCCTTTTACCTTTCAATTTTTC
ATGATAATTTTAAATAAAAATACATTAGTTACCCCCATAATTTTCTTAATTCTTACCTATGAAAACAATTTCCCCACCTTAATAAATACTTCTAGCTTCGCCACTGAGCTTAGGGGAAGC
TAATCGAAGATGAATATTGATGCAGAACTGAGAAGTTTCATGGGGACCATTTCACATTTTAGACAGCTACATATCAATGATTCTTGTTTGTTCTTTGGAATCTGCTCACATTGATCCTTA
GAAGAGTGCCTGTGGGTTGGCTATGCATACCTGTTGAAAGTTCATATGTTTAAATAGGGCACTTTGAAAGGACTTGTATTTTCACTCTTCATTTATGAACCATGGCAGGTTCACCACATT
TGAGGGACATCTTTTATCGGATGGGTCTGTCTGATAAAGATATCGTGGCACTTTCTGGAGGTCATACTCTG
GTAATTCTGTAGAACTGTTTCTGATGTTCTACGTAGATCTGATAAGCCA
CATATGCTCAAATCTGTAATTCTTTTGGCGGATATTGTTCTGTTTAGGGAAGGGCACATCCAGACAGATCCGGTTTTGAAGGGCCCTGGACTCAGGAACCTCTAAAGTTTGATAACTCGT
ATTTTGT
GTAAGTTTTAAAGCAAGCTCAGCATACTACCATTTATCTGTGTAGAGATTATGAAATTAATTAATCTTTCACTCACTGGCGGTACTAGGGAAATGTTGAAAGGGGAGACAGAC
GGGTTATTGAAACTTCCAACAGACACTGCTTTGTTGGATGACCCTGCGTTCCGTCCTTATGTTGAGCTGTATGCTAAG
GTAATGTGGGCTTTTATTTTTACCAAATGACTTGTTGCATGA
ATGGCTCGTCAAAACTTTTCCGATCCCCTTTCAACCTGCTTTGATTTTTCAATGCAGGTTGGGTCTGGATAAAACTATTGGCTCGACCATCTTGAAACCTAGTTTTATGCATTTTATTTT
CCTTTTGATAGATCTTTTTTAAGTGATGGGTAACGGTTCGAAAGTGGTTTTTTTGAACACCAATGAATTACATTGTCCAGGGTTAGTTTGGACCCTAATATATCTTACCCTAAAGTGGGC
TTTCTGGCCCTTTTCAAGCTTCTATTCACCAACTAGCATCCTTATGGTTCTTTGCCCCCCTTGGGATTGGGAATCGCAAGGGTAAATCTATACCTTGGTGTCGTAGTTAGATTCATGGAC
TGTGGGGTGACTTCAACGTGCTTGCTTAACTCTGGGGGTATAATATGATACGTGATTTCTTTTTGTTCAATTTTTATTGTTTCTCAGGACGAAGAAGCATTCTTTAGAGACTACGCGGCT
TCGCATAAGAAGCTTTCAGAACTGGGGTTCACTCAAGGGTCTTCTGGGTTCAAGGTAAAGGATACCACTGTACTGGCACAGAGTGCAGCTGGAGTTGCAGTTGCTGCGGCTGTTGTGATC
CTTAGCTATTTCTACGAAGTTCGCAAGAAAATGAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTACCGGTCGTTGACACAGAGTACCTGAAAGAGATCGACAAAGCACGTCGCGATCTCCGTGCTCTCATCGCTTACAAAAGCTGCGCTCCTCTCATGCTTCGCTTAGCGTGGCAT
GATGCAGGAACGTATGATAAGAACTCGAAAACAGGAGGAGCTAATGGTTCGATAAGGAATGAAGAAGAGTACTCTCATGGTTCTAATAGTGGCTTGAAAATAGCTATCGATTTTTGCG
AG
GGAGTGAAGGCGAAACATCCGAAGATTACTTATGCGGATTTATACCAG
CTTGCAGGTGTTGTTGCAGTGGAGGTCACTGGGGGTCCAACCATTGATTTTGTTCCTGGTAGAAGGGATTCA
AATATTTGTCCCAAGGAAGGGCGACTTCCAAATGCTAAACTAG
GTTCACCACATTTGAGGGACATCTTTTATCGGATGGGTCTGTCTGATAAAGATATCGTGGCACTTTCTGGAGGTCAT
ACTCTG
GGAAGGGCACATCCAGACAGATCCGGTTTTGAAGGGCCCTGGACTCAGGAACCTCTAAAGTTTGATAACTCGTATTTTGTGGAAATGTTGAAAGGGGAGACAGACGGGTTATTG
AAACTTCCAACAGACACTGCTTTGTTGGATGACCCTGCGTTCCGTCCTTATGTTGAGCTGTATGCTAAG
GACGAAGAAGCATTCTTTAGAGACTACGCGGCTTCGCATAAGAAGCTTTCA
GAACTGGGGTTCACTCAAGGGTCTTCTGGGTTCAAGGTAAAGGATACCACTGTACTGGCACAGAGTGCAGCTGGAGTTGCAGTTGCTGCGGCTGTTGTGATCCTTAGCTATTTCTACGAA
GTTCGCAAGAAAATGAAGTAG

Retrieve as FASTA