Entry information : PtAPx05 (POPTR_0005s11430 / Potri.005G112200)
Entry ID 2876
Creation 2006-04-04 (Felipe Teixeira)
Last sequence changes 2006-04-04 (Felipe Teixeira)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: PtAPx05 (POPTR_0005s11430 / Potri.005G112200)
Name (synonym) PtAPx05 (POPTR_0005s11430 / Potri.005G112200)
Class Ascorbate peroxidase    [Orthogroup: APx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation Peroxisomal
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtAPx05
start..stop
S start..stop
CroAPx03 476 3e-172 2..286 3..289
CsAPx04 468 5e-169 1..287 1..288
LeAPx06 466 3e-168 1..287 1..287
CclAPx06 465 1e-167 1..287 1..288
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8260126..8260238 113 N° 2 8259824..8259948 125 N° 3 8259644..8259693 50 N° 4 8259386..8259451 66
N° 5 8259267..8259315 49 N° 6 8259093..8259175 83 N° 7 8258937..8259016 80 N° 8 8258726..8258828 103
N° 9 8258296..8258490 195  
complement(join(8258296..8258490,8258726..8258828,8258937..8259016,8259093..8259 175,8259267..8259315,8259386..8259451,8259644..8259693,8259824..8259948,8260126. .8260238))


exon

Literature and cross-references PtAPx05 (POPTR_0005s11430 / Potri.005G112200)
Literature Ralph,S., et al., Genomics of hybrid poplar (Populus trichocarpax deltoides) interacting with forest tent caterpillars (Malacosoma disstria): normalized and full-length cDNA libraries, expressed sequence tags, and a cDNA microarray for the study of insect-induced defences Mol. Ecol. 15 (5), 1275-1297 (2006).
DNA ref. Phytozome 11:   scaffold_5 (8260238..8258296)
Cluster/Prediction ref. JGI gene:   679120
Omic ref. ePlant:   Potri.005G112200
Protein sequence: PtAPx05 (POPTR_0005s11430 / Potri.005G112200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   287
PWM (Da):   %s   31391.22 Transmb domain:   %s   o259-281i
PI (pH):   %s   7.2
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGKVVDAEYSKEIEKARRDLRALIASKSCAPIMLRLAWHDAGTYDAKTKTGGPDGSIRNEKELAHAANNGIKIAIDFEGIKAKHPKITYADLYLAGVVAVEVTGGPTIDFVPGRKDSPESPEEGRLPDAKQGATHLRDVFYRMGLSDKDIVALSGGHTGRAHRDRSGFDGPWTKEPLKFDNSYFQELLKGDSEGLLKLQTDRVLVEDPKFCKYVLLYADEDAFFSDYAASHKKLSELGFTPPSSSLKAITKNRTLLAQSAVGVAVAATVIILSYFYEINRRV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). Only EST from Populus tremula.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGAAAAGTTGTAGATGCCGAGTACTCAAAGGAGATTGAGAAGGCTCGTCGAGACCTTCGCGCTCTCATTGCTAGCAAAAGTTGTGCTCCCATCATGCTTCGTTTAGCGTAAGTA
CAATCTCTGCATTTATCTGTTTATAACAAAAGTCCTGTGTACATTAAATTGGTATTTGCGTGTACAAATATATATTTTGTTTGGATGGTTGATATTGGATAGTAAGGACTGCGTAGCAAT
AGCTTTTTCTCGAAATTTTTTAATGGTGTTTTTTGGAATGTTTATTGCAGGTGGCATGATGCAGGGACTTATGATGCAAAAACAAAGACAGGAGGGCCCGATGGTTCCATCAGGAATGAG
AAAGAGCTGGCACATGCTGCAAACAATGGTATCAAAATTGCTATTGATTTTTGTG
GTGAGTTTCTTACCCCCTTTTGTGAATCATTTGATCTGACATTATTAGTAATTTAGTGAAGATTC
AAAGAAACTGTAAGGGGAAAAACAGATTTTTTTTTTCCTGCTAATGGCCTACGTTTTCGTTTCAGAGGGAATCAAGGCCAAACACCCCAAAATTACATATGCTGACTTGTATCAGGTGAT
TATCTTTTTCTTATAGTCAAAGAACCATCTCTATTCTCATTATGTTAATTAGCTTCACTGCAGAGAATACTTGATCAGATAGGCTAAGAACACTTTTGAAATCACAGTGGCTAGTTGTTT
ATGATAGGAAAACTATGGTGTTATGATTCCATCTTTAACTTATTCTCAATCATTCTCGAATGTTTAGCTTGCTGGGGTTGTTGCAGTTGAGGTAACCGGAGGCCCTACTATTGACTTTGT
TCCAGGAAGAAAG
GTAATGTTCATGGTAGAACTTCATTAACTTTTTCTTACTACCGTGAAGTAAAATTTTGTTTTTCAATTAGGATTCGCCGGAATCTCCTGAAGAAGGGCGTCTTCCTG
ATGCAAAACAAG
GTTTTTCTCTATAATGACTCGGCTCAATTCATTCCTTTATAGCTTTTCTATGATATGGAAATTATTCTATTCTGATTCATTCTGGTTGCAGGAGCAACACATTTAAGG
GATGTGTTCTATCGCATGGGTCTATCGGACAAGGACATTGTGGCACTGTCTGGAGGCCACACATTG
GTACGTTTTGACCGATGCAGTTCTTTTCTAGGTCGTCAAAACATACCTAAAGTT
GATGTTGCTTTGGGTTTTGTAGGGAAGGGCTCATCGAGATAGATCAGGCTTTGATGGCCCTTGGACAAAGGAGCCTTTGAAGTTTGACAACTCTTACTTCCAGTACGGACATATTTAATT
TTGAGCTCATTCCATATGCCAGCTAACTAGCATAGTTTGCAAAGTCATGGTGAAAGCAGATATAAAGAATCTCTTTTTTATTGCAATCAGGGAGCTCTTGAAAGGGGATTCAGAGGGACT
GTTAAAACTGCAGACAGACAGGGTTCTTGTTGAAGATCCCAAGTTCTGCAAATATGTCTTGCTGTACGCAGAG
GTAATATTCTCATGAACTTTGAAAGATTACATATTCTCCATGTTGTG
TTGCCTTGCTGTGACATATTTTAGCAGCCAACTTAAGGTTTTCTTCAGTTTCAGTTGCATGTCGTTCGTCATTAATACGAGGTAGTTTCCATTTGATGTGTTCTTGTTAGATGGAGATTA
ATTTAGGAAAGTTACGAATCAGCTGCTGATTAGAAAGTAAACTGAGAAAGTTGTTGGTTAAATGGCAGGATGAGGATGCATTCTTTTCAGATTATGCAGCATCACACAAGAAGTTATCAG
AGCTGGGCTTTACTCCTCCTTCCTCGAGTCTCAAAGCAATTACAAAGAACCGTACCTTGCTAGCTCAAAGTGCTGTGGGAGTCGCCGTTGCTGCAACTGTAATAATCCTAAGTTACTTCT
ATGAAATCAACAGAAGAGTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGAAAAGTTGTAGATGCCGAGTACTCAAAGGAGATTGAGAAGGCTCGTCGAGACCTTCGCGCTCTCATTGCTAGCAAAAGTTGTGCTCCCATCATGCTTCGTTTAGCGTGGCAT
GATGCAGGGACTTATGATGCAAAAACAAAGACAGGAGGGCCCGATGGTTCCATCAGGAATGAGAAAGAGCTGGCACATGCTGCAAACAATGGTATCAAAATTGCTATTGATTTTTGTG
AG
GGAATCAAGGCCAAACACCCCAAAATTACATATGCTGACTTGTATCAG
CTTGCTGGGGTTGTTGCAGTTGAGGTAACCGGAGGCCCTACTATTGACTTTGTTCCAGGAAGAAAGGATTCG
CCGGAATCTCCTGAAGAAGGGCGTCTTCCTGATGCAAAACAAG
GAGCAACACATTTAAGGGATGTGTTCTATCGCATGGGTCTATCGGACAAGGACATTGTGGCACTGTCTGGAGGCCAC
ACATTG
GGAAGGGCTCATCGAGATAGATCAGGCTTTGATGGCCCTTGGACAAAGGAGCCTTTGAAGTTTGACAACTCTTACTTCCAGGAGCTCTTGAAAGGGGATTCAGAGGGACTGTTA
AAACTGCAGACAGACAGGGTTCTTGTTGAAGATCCCAAGTTCTGCAAATATGTCTTGCTGTACGCAGAG
GATGAGGATGCATTCTTTTCAGATTATGCAGCATCACACAAGAAGTTATCA
GAGCTGGGCTTTACTCCTCCTTCCTCGAGTCTCAAAGCAATTACAAAGAACCGTACCTTGCTAGCTCAAAGTGCTGTGGGAGTCGCCGTTGCTGCAACTGTAATAATCCTAAGTTACTTC
TATGAAATCAACAGAAGAGTGTAG

Retrieve as FASTA