Entry information : PtAPx06 (POPTR_0004s18030 / Potri.004G174500)
Entry ID 2877
Creation 2006-04-04 (Felipe Teixeira)
Last sequence changes 2006-04-04 (Felipe Teixeira)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: PtAPx06 (POPTR_0004s18030 / Potri.004G174500)
Name (synonym) PtAPx06 (POPTR_0004s18030 / Potri.004G174500)
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation Peroxisomal
Tissue types Buds
Leaves
Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtAPx06
start..stop
S start..stop
PtoAPx01 581 0 1..286 1..286
PtAPx04 520 0 1..285 1..285
PbAPx05 520 0 1..285 1..285
PtremAPx02 506 0 12..258 1..247
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18043502..18043614 113 N° 2 18043296..18043420 125 N° 3 18043166..18043215 50 N° 4 18042205..18042270 66
N° 5 18042077..18042125 49 N° 6 18040657..18040739 83 N° 7 18040481..18040560 80 N° 8 18040288..18040390 103
N° 9 18039570..18039761 192  
complement(join(18039570..18039761,18040288..18040390,18040481..18040560,1804065 7..18040739,18042077..18042125,18042205..18042270,18043166..18043215,18043296..1 8043420,18043502..18043614))


exon

Literature and cross-references PtAPx06 (POPTR_0004s18030 / Potri.004G174500)
Literature JGI
DNA ref. Phytozome 11:   scaffold_4 (18043614..18039570)
Cluster/Prediction ref. JGI gene:   556634 UniGene:   Pth.1428
Omic ref. ePlant:   Potri.004G174500
Protein sequence: PtAPx06 (POPTR_0004s18030 / Potri.004G174500)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   286
PWM (Da):   %s   31418.15 Transmb domain:   %s   o257-279i
PI (pH):   %s   7.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALPVVDTEYLKEIEKARRDLRAVIAYKNCAPIMLRLAWHDAGTYDKNTKTGGANGSIRNEEECSHGSNNGLKIAIDSEEVKVKHPKITYADLYLAGVVAVEVTGGPTIDFVPGRRDSNTCPKEGRLPNAKLGSPHLRDIFYRMGLSDKDIVALSGGHTGRAHPERSGFDGPWTQEPLKFDNSYFVELLKGQTEGLLKLPTDTALLDDPDFRPYVELYADEEAFFRDYAASHKKLSELGFTPRSSVVKVKDSTVLAQSAVGVAVAAAVVILGYFYEVRKKMN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns) and 1 EST. Unigene contains ESTs from PtAPx04 and PtAPx06
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTACCGGTTGTTGACACAGAGTACCTGAAAGAGATCGAAAAAGCACGTCGCGATCTCCGTGCTGTCATCGCTTACAAAAACTGCGCTCCTATCATGCTCCGCTTAGCGTAACCA
ACTAACTAGCTTTCTCATTGCTTACTCTCTCTCTCTGTTTGAATCTTTCTGTTTTGATTTTTTTTTCGGTGAAGGTGGCATGATGCAGGAACTTATGACAAGAACACGAAAACAGGAGGT
GCTAATGGTTCGATAAGGAACGAAGAGGAGTGCTCTCATGGTTCTAATAATGGCTTGAAAATCGCTATCGATTCTTGCG
GTTAGTTTCTTACTTGCTTTCCACTTAAATTTCACTTATAT
TTTTGTTGATTTTGATTTTGATTTTTTGAGTTTTTTCAGAGGAAGTGAAGGTGAAACATCCGAAGATTACTTATGCAGATTTGTATCAGGTGATCTGTTTCACTCCAGTAGTGTTTGATT
AAGTAATACTGCAGATAATTAAATAAATGTTTAATTAATACTGTTTATTATTCTCCATCTATATGTCTATTTAATTTGTTGTTTCAGTATTGGTAGCTAATAATTATACTGATAATCAAA
GCCTAAACTGATTTTCTTGTCAAAAAGTAACAGTATGTAGAGATATAATTGAAAAACTTGAGTAAATGAAGTAGCGATTATCCGCGTGGGTGTGTGGCGGAGGTGGAACATTCCTTGGTA
AATCTAACCTTATGATTTGTGGATGGAGATAGAAATTCTAAGGACATTACCGCCACTGACAGGACTGAATCACAAGTGGAAGTTCTAAAAATATGTCTTGTCTGACCTGTCTAGTCAATC
TTCACAAGAAATGTGAGTGAATGGCGATGAAATGATGATTCCTAGTCATGCAAGTATAGCATAAGGTGGTTCCTGTTCTATTTTCTTCCATGTTGGTATTGAATGCTCACAAATATAGAT
ACCTGACGTATTTTTCTAATTCATGATTAGGTTTCTAAATTTTTCGGGGAAGAATTTGGAGAGATATTCTTTTAGTATGTTACCGTAGCAATTCAGTTGGAATTTGTTGAAGCATGCTGG
GAGTTGGGCAACATTAGATGCACTATCATGGTTGCTGTTCTGTTCCTTGGCATGATACACAAAATATTTGCAAAATTATGAACAGACCAGCAAGCCATAACTCCATGATTGCTGCATCAG
TTAGTACATTAAGCTTAACATGCGAGTAATTGATATATAATGAGTGGTGGATTTTAATGTAAAATGTTTGAATATCCAAGTACAATTGCTGGGTTTTAAAATATAAGGAGCAACTGACTC
ATATTCAACTACTTGCATGTTCAGCTAGCAGGCGTTGTTGCAGTCGAGGTCACTGGAGGTCCAACCATTGATTTTGTTCCTGGTAGAAGGGTATGTGATTGAAGCATTTCTTGAAGATGC
AGGTGATTATCAATTTATAACATTGCTGACTATATGTTCATTTTCTTAGGATTCAAATACTTGTCCCAAGGAAGGGCGACTTCCAAATGCCAAACTAGGTATTTTCAGTAGAAACTTCTT
TAGTTTAATTCAGGGGTTGGAAGTTCTTAAATTGTGGTGTGCTTTCTTTTAATGTATGAACTGAGCTAAACCTGGTCTAAAGGGAAAGGTGGAATTATGTGTTTTGGGATTTGTGTCTTT
GTGATGCTGTAAATAAACTTATTTATTGTGTGTTTACAGCATCAATGAATCTAATAGTTGAGGGTATTGTGTTGTATGGGACTGACGTGCAGTAGATTGGAATTATGTGTTTTGGGATTT
GTGTCTTTGTGATGCTGTAAATAAACTCATTTATTGTGTGTTTACAGCATCGATGAATCTAATAGTTGAGGGTATTGTGTTGTATGGGACTGACGTGCAGTAGATTGGATTCTCTAGATA
TAATTTTTCATTGAATTTATCTGTCTTCTAGTAGTCTTCTCAGTAGATTGAATTGCCATTTCAACAATTTAGTTTTCCAGTTTCTGAGAATTCATTTCCACGCGGACCCAAAAGCTCTTT
CCATAACACGTGGTGTTGTATTGAACATCAGGTGAAGTTTTAGTCAGGATTGTAAATTGTTATGGTGTTCAGCTAAGAAGCAGAACTGTGACATAAAATGCAGAGCAAGTTTTTCTTGAT
TTAATGCATTTGTTTACTCTAATAAGCTTTGTGCATGAAATTGACACATGCTAGATTTTAGGCAAGATTATTTGTAGGTGAATCACGTATAATTGCATGTTTGTTAGAAACAGAACTTTT
TGTATGCTAATTCTTCCGCCTTTTCTGTACTAGTTTTTTTTGACTAATTCATTGCATTACATTAGAGTTCTGTCTCATAAAATCACTCCTAAATCCATAGATTTCTACATTTAATAGGTG
GTTTAATGTGGAGGAGAGTCAGGTTGTCGTATCTCAATTCAAGTGATGATCTTTACTTTTGTTGGTTCTGCTCATAGAGCAGCCATGCTGATCTGTCCTTTCATCTCACAACATGCATAT
ATTTGTGCTGATTTCTGTGTAATAATGATTTGTCGAAGTTGTAATTTGCAGCTGTTCTATGACTGTAAAGAATAGTTGTTTGATCTTCACATGGCTGTTTATTTAGACTATCAGCTTAGG
GGAAGTTACTCACAGATGAATATTTATCCAGGGCTTATAAGTTTCATGGAGACCATCTCACATTTTTAGACAGTTCCATATTAATGATCTTTGTTTGTTGTTCTTTGGAATCTGTTACCA
TGAAGTTTTATAAAAGTACCTGTTGGTTGGCCATACGCTGTTGAGCGTTCATATGTTTAAATAGAGCACTTTGAAAGAACTTGTATTTTCATTATTCATTTCTGAAATATGGCAGGTTCA
CCACATTTGAGGGACATCTTTTATCGGATGGGCCTGTCTGATAAAGATATCGTGGCACTTTCTGGAGGTCATACCCTG
GTAATTCTCTAGAACTGTTTCTGACTGTCAATGTAAATCATA
TAAGCCGCAGATGCACAAATTTGTAATTCTTTTGCTGGCTATGATTCTATTTAGGGAAGAGCACATCCAGAGAGATCAGGTTTTGATGGCCCCTGGACTCAGGAACCTCTAAAGTTTGAT
AACTCATACTTTGT
GTAAGTTTTAATGCAAGCTCAGCATACTACCATGTTTCGTTGTGTAGAAATTATGAAATTAATCAATCTTTTACGCACTGTTGATACTAGGGAACTATTGAAAGGG
CAGACAGAGGGGTTGTTGAAACTTCCAACAGACACTGCTTTATTGGATGACCCTGACTTTCGTCCTTATGTTGAGCTGTATGCTAAG
GTAATGTGGGCTTTCGTTTCGACCAAATGACTT
GTTTCATGAATGGGTCATCATAACTTTTCCTATCCCCTTGCAACCTGAGTTGATTTTTCCATGCAGTTTGGGTCTGGAAACTATTGGCTTGACCATCTTGAAACCTGATTTTATGCATTT
TCATTGCCTTTTGATGGTTCCTTTTCAAATGATCCCAAGTATTTTTTTTTGAACAACAATAATTAAATAGTCCGGGGTTAGCTTGGACCATAATCTAATCTTAACCTAAATTGGGCCTTA
TGTGGCCTTTTTCGAGCTTCTGTTAAGGGTTCTTATGGCCTACCTTACGACTGGGAATCGCAAGGGTAAATACATGCCTTGATTTGCACCTCGATCTAGAATCATTAATAAAGAATACCC
ACCGTTCAGATTGGTGTCGCAGTTAGATTCTTAGTGTGGGATGACTTGTGATGTGGTTTATTTCTGTTGCTTCACCTTGGCGATCTAATATGATATCTGATATCTCTTTTCTTCAATTTT
TGTTGCTTCTCAGGATGAAGAAGCATTCTTTAGAGACTACGCTGCCTCGCATAAGAAGCTATCAGAACTGGGGTTCACTCCAAGGTCCTCTGTAGTCAAGGTAAAGGACAGCACTGTACT
AGCACAAAGTGCAGTTGGAGTAGCAGTTGCGGCAGCTGTTGTGATCCTTGGCTATTTTTATGAAGTTCGCAAAAAAATGAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTACCGGTTGTTGACACAGAGTACCTGAAAGAGATCGAAAAAGCACGTCGCGATCTCCGTGCTGTCATCGCTTACAAAAACTGCGCTCCTATCATGCTCCGCTTAGCGTGGCAT
GATGCAGGAACTTATGACAAGAACACGAAAACAGGAGGTGCTAATGGTTCGATAAGGAACGAAGAGGAGTGCTCTCATGGTTCTAATAATGGCTTGAAAATCGCTATCGATTCTTGCG
AG
GAAGTGAAGGTGAAACATCCGAAGATTACTTATGCAGATTTGTATCAG
CTAGCAGGCGTTGTTGCAGTCGAGGTCACTGGAGGTCCAACCATTGATTTTGTTCCTGGTAGAAGGGATTCA
AATACTTGTCCCAAGGAAGGGCGACTTCCAAATGCCAAACTAG
GTTCACCACATTTGAGGGACATCTTTTATCGGATGGGCCTGTCTGATAAAGATATCGTGGCACTTTCTGGAGGTCAT
ACCCTG
GGAAGAGCACATCCAGAGAGATCAGGTTTTGATGGCCCCTGGACTCAGGAACCTCTAAAGTTTGATAACTCATACTTTGTGGAACTATTGAAAGGGCAGACAGAGGGGTTGTTG
AAACTTCCAACAGACACTGCTTTATTGGATGACCCTGACTTTCGTCCTTATGTTGAGCTGTATGCTAAG
GATGAAGAAGCATTCTTTAGAGACTACGCTGCCTCGCATAAGAAGCTATCA
GAACTGGGGTTCACTCCAAGGTCCTCTGTAGTCAAGGTAAAGGACAGCACTGTACTAGCACAAAGTGCAGTTGGAGTAGCAGTTGCGGCAGCTGTTGTGATCCTTGGCTATTTTTATGAA
GTTCGCAAAAAAATGAATTAG

Retrieve as FASTA