Entry information : PtGPx02 (POPTR_0007s02160 / Potri.007G126600)
Entry ID 2884
Creation 2006-03-20 (Felipe Teixeira)
Last sequence changes 2006-03-20 (Felipe Teixeira)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtGPx02 (POPTR_0007s02160 / Potri.007G126600)
Name (synonym) PtGPx02 (POPTR_0007s02160 / Potri.007G126600)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue types Buds
Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtGPx02
start..stop
S start..stop
HbGPx02 315 2e-112 1..167 1..167
EgrGPx02 313 4e-111 1..167 36..202
EglGPx01 313 5e-111 1..167 36..202
EguGPx01 310 6e-110 1..167 36..202
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1284568..1284612 45 N° 2 1283968..1284044 77 N° 3 1283174..1283235 62 N° 4 1282948..1283066 119
N° 5 1282609..1282776 168 N° 6 1282488..1282520 33  
complement(join(1282488..1282520,1282609..1282776,1282948..1283066,1283174..1283 235,1283968..1284044,1284568..1284612))


exon

Literature and cross-references PtGPx02 (POPTR_0007s02160 / Potri.007G126600)
Literature JGI.
DNA ref. Phytozome 11:   scaffold_7 (1284612..1282488)
Cluster/Prediction ref. UniGene:   Pth.1748
Omic ref. ePlant:   Potri.007G126600
Protein sequence: PtGPx02 (POPTR_0007s02160 / Potri.007G126600)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167
PWM (Da):   %s   18655.46  
PI (pH):   %s   5.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEESPKSIYDFTVKDIHGNDTSLSEYSGKVLLIVNVASKCGLTHSNYKELNVLYEKYKNGFEILAFPCNQFAGQEPGSNEEIQDTVCTIFKAEFPIFDIDVNGKNTAPVYKFLKSEKGGYFGDAIKWNFTKFLVNKEGKVVERYAPTTSPLKIEKDIQNLLGSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAAGAAAGTCCCAAGTCCATCTATGACTTCACTGTCAAGGTAATGTTCAATCTTCTTCCTTCTTTTTCATTGTTTGCTGTGTGGTTGGTGAGGAAACGGGAAAAAGTAGAGAAC
AGAGGACAAAGCTTTAAACTCTTATTGTTTTGTTATGGATTTGTTGATGTTCTGTGTGTTAATTCATTGCTTGAGCTTTTGACTTTTATTGAATATTTGTTGGTTCTTAATCTTGCTGAA
CATCATTGGTATGGGGCCCTTCAAATAGAGTTTTGTAGTCCAGGATTCAGATACGGACATTTGACTTGAGTTATTTCCAGTCCAGGCTATGTCTATGAGCAAGGCTGATGATATCATATT
CAAATGGATAGTGATACTCTAATTCCAAGTCCTCTGTGTATTTTATTTTAATTATTGCTCCTTCTTTTTAGATAACTGAGCCATGGTGTAGTTAGGGTAATATGGAATTGTGATTTGCAG
ATTAGAGGTTGTTTAGATGGCAACATCAATTATGTTTCTTGAAGTTGAGGAATCCCAGATTTATATAACGTTTCTTGCTGTGTTGCAGGATATCCATGGAAACGATACGAGTCTAAGTGA
ATACAGTGGGAAGGTGCTCCTTATCGTGAATGTTGCTTCCAAATG
GTAATCTATCATGATCTCTTTCGTGTCTGGCATTCTGGCTTTCTGGTTTCCTGAATTAGTTCTCTATCAGCATCT
CACCAGTTTTGGGCAAACTAGTCCAGTTTGTCAACTACCATTGACATGTAAATGTCTATTGGGATACCTAATATTCTTTCTCTGACAGCAAGGTTGGCACCAAAATACCTGTTGTCTTCA
TAGCATGTGTAAAAATTTTCCACTTGTTGAAGGTCTTAGAATCGTAATCGTATTTTTATCTGTGATAGAACATTTTCTGAATGCAAAGAATCTAATCATCTATGATTATAATCAGCAGTA
TGTAGTCTCTAGGGCAGATGATCTAGGATTATATAGATATATAGGAACTTATCATACATGTATGAGGGAAAAGTGCTTGTTCAGAAATTCCCAGCTCTGCAGCATCGAGGGCTGTTGCTG
ACCAATATTTGGAAAATGAGTTTCACTTCAACATTTGATGTATACCTGATTGGGATCTTCATATAGCATAGCCTTTTCTTTTAGGCTGAAGCCTCTTTTTATCATTGGTAAGTTGCATGC
TTATTTCTGTCAAAACTTTGGAATTCTTCATGATCATCAATATTTTAACTGAAAACGTTCTTCTTGTACTTTTGTTAGTCATATGACTTGTATGAATTAAATTTACTTTTGCAGATAAAT
TTAAATTGTTCAAATGAGCCTTTTGACTGTTATTGAATCTTATTTTTTATTCTGCAGTGGCCTCACACATTCAAACTACAAGGAATTGAATGTTTTGTATGAAAAGTACAAAAACCAAGG
TTGGTCACTCATTCTCATAGAGCAACATCCCTATTTTTGAGACGTTTGATTACAATATCTCTATAGATTTGAGGTTTTAACTTCTCGGCTGGCACGATCATGGTAGGGTTTGAGATCTTG
GCATTTCCTTGCAACCAGTTTGCTGGACAAGAACCAGGAAGCAATGAAGAGATTCAGGACACTGTATGCACAATTTTCAAAGCTGAATTCCCAATCTTCGATAAG
GTAATGCTTAATGAA
AGAAAGATTTGAAAAAAGTAGGATAAATTATTGCCACTGTTTTCTCAGCTCTAAACACCCTGATGCAAATATTCCTAATAAAGGGACCCAGGTTTTATCAGTTCTTCAATTTGATAGAAT
ATGGAGATGTTTTGAATATGCTCTATCTGGTTATAGATTGATGTGAATGGGAAGAACACAGCACCTGTCTACAAGTTCTTAAAATCAGAGAAAGGAGGGTATTTTGGAGATGCCATCAAG
TGGAACTTTACCAAATTTTTGGTAAACAAAGAAGGAAAGGTTGTTGAGAGATATGCTCCTACTACATCACCTCTTAAGATTGAG
GTCAGATCTCTTTTTTCCCCCTATTACAACTTTCGG
GTCCAAGGACTTCTGCGAACTTCATCTGACATTTCTTTATTCCATTTTGCAGAAAGACATTCAGAATCTGCTGGGATCTTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAAGAAAGTCCCAAGTCCATCTATGACTTCACTGTCAAGGATATCCATGGAAACGATACGAGTCTAAGTGAATACAGTGGGAAGGTGCTCCTTATCGTGAATGTTGCTTCCAAA
TG
TGGCCTCACACATTCAAACTACAAGGAATTGAATGTTTTGTATGAAAAGTACAAAAACCAAGGGTTTGAGATCTTGGCATTTCCTTGCAACCAGTTTGCTGGACAAGAACCAGGAAGC
AATGAAGAGATTCAGGACACTGTATGCACAATTTTCAAAGCTGAATTCCCAATCTTCGATAAG
ATTGATGTGAATGGGAAGAACACAGCACCTGTCTACAAGTTCTTAAAATCAGAGAAA
GGAGGGTATTTTGGAGATGCCATCAAGTGGAACTTTACCAAATTTTTGGTAAACAAAGAAGGAAAGGTTGTTGAGAGATATGCTCCTACTACATCACCTCTTAAGATTGAG
AAAGACATT
CAGAATCTGCTGGGATCTTCCTAA

Retrieve as FASTA