Entry information : PtGPx06-1(POPTR_0001s09270 / PtGPx06-1 / Potri.001G105200)
Entry ID 2886
Creation 2006-03-20 (Felipe Teixeira)
Last sequence changes 2006-03-20 (Catherine )
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-04-21 (Catherine )
Peroxidase information: PtGPx06-1(POPTR_0001s09270 / PtGPx06-1 / Potri.001G105200)
Name PtGPx06-1(POPTR_0001s09270 / PtGPx06-1 / Potri.001G105200)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtGPx06-1
start..stop
S start..stop
PtGPx06-2 319 8e-113 1..168 71..238
MdGPx06 310 2e-110 1..168 1..168
VvGPx06 309 4e-110 1..168 1..168
GhGPx06-2 307 3e-109 1..166 1..166
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8386104..8386151 48 N° 2 8385565..8385641 77 N° 3 8385166..8385227 62 N° 4 8384765..8384883 119
N° 5 8384372..8384539 168 N° 6 8384233..8384265 33  
complement(join(8384233..8384265,8384372..8384539,8384765..8384883,8385166..8385 227,8385565..8385641,8386104..8386151))


exon

Literature and cross-references PtGPx06-1(POPTR_0001s09270 / PtGPx06-1 / Potri.001G105200)
Literature JGI.
DNA ref. Phytozome 12:   Chr1 (8386151..8384233)
EST ref. GenBank:   DT486858
Cluster/Prediction ref. JGI gene:   709364 UniGene:   Pth.4729
Omic ref. ePlant:   Potri.001G105200
Protein sequence: PtGPx06-1(POPTR_0001s09270 / PtGPx06-1 / Potri.001G105200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18635.48  
PI (pH):   %s   7.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASQSSAQSVHDFTVKDARENDVDLSIYKGKVLLIVNVASQCGLTNSNYTELTQLYDKYRDGLEILAFPCNQFGSQEPGNNEQIVEFACTRFKADYPIFDVDVNGKNAAPIYKFLKSNKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTTSPLSIEKDVKKLLGIA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 63 ESTs. Tamdem with PtGPx08. Unigene Pth.4729 compiles ESTs from PtGPx06-1 and -2.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGCCAATCCAGTGCTCAATCAGTTCATGATTTCACTGTTAAGGTAATTTTTTGTTGTATTTTATTTATGGTTTTTCTCTCAGTCTTTCTCAATAAAGTTGCTCGCTTGATGCTG
ATATTGAGGTTTTGGTATCATAACTGGCTTTTATTTTCCTTTTTTGTTTGTTTGATTTGAACGGTGCTTAATAGTAGTCTAATCATTTGTTTTGCTGCTGGAAATTTAGAGGATCTCTTT
AATTGTTGTTAAGGGGGGAAAAAGGACTAAAATGGTTTTTTATGCAAGGAAGGTCTTATTTCTTAAGGTTGTTGAGGTGGTACGAACTAGCATAATTTCAATCTGTGGATGTGCGGCTTA
TTGGCTGTTTCTCTGTTACCACTCAAACTGTGGATGTGCGGCTTATTGGCTGTTTCTCTGTTACCACTGAACCATCTAATGTATTAACTATGATTCCTCTGTGTTCTACTTATATTTATA
TATAATGCCTTGGTTCTCTCTTGACTGTAGGATGCTAGGGAAAATGATGTTGACCTCAGCATATATAAGGGGAAGGTCCTCTTGATTGTCAATGTTGCTTCACAATGGTAATTCATTTCG
TCCCTTTTCATCTGTCCTTAACGGGAAGAGACTGAGGGGTTTTCTGGTTTTTATTAAAGAGATGTCCATTTCTTTTAAGGATAACTATGCTGTAAGATAATGCTCCTCGACTCAGTTCCA
ATCTCCCTGGACTAATAATTAGTGTGCCACAGGGTTTCGTCAGTGAGTTCACTCCTCATTTTGTTGAAATCACAGAGCGTGAAGTGAACTCATAAGTTGGGAAATAAGGGTGAAGAATCC
CTTTCAATTGAAAGAGGATCCTTCTTCACCATCTCTTAGACAGGAGTTTATTGTTTACTTCTCTAACCTTTAATTTTGGTGCAGTGGCTTGACCAATTCAAACTACACGGAGTTGACCCA
GCTATATGACAAATACAGGGATCAAG
GTAAACTTCTATTATATTTTATGTTTTGTGTTGTGGCACTTAAATGTTTACTGACTTGTATGTGGCTTTTTTTTCATGAGTTAGCTTCTGCTCT
AGGAATATATGAACCCCTATTAGTCACTAGCTGGGCTGCTACATGGGTTTGCCTGTATCTTTCTGATGACTTTTTGCGAAGTTCAACTTCGTATCTAATTGATTGGCATGGCTAAACCTT
GCAAGTCATTGCCATCTTGCTGTAATGCCCGTTCTTTTTTCTTATCACTTGCCTTTGTGCTGATGCAGGTTTGGAGATTCTGGCTTTTCCATGCAATCAGTTTGGATCTCAGGAGCCAGG
GAACAATGAACAAATAGTGGAGTTTGCTTGTACTCGCTTTAAGGCTGACTATCCCATATTTGATAAG
GTATGCTAACTCTGAGATTTTACAGCCTGATGAAGATGGATTTCTTAATTTAT
AATCAATTTTCTTTCTCGCATGACTGCCAAAATTTTCCCACCATTTCATGTTTGAGTTTTTGATGAACATTCAATAATTGAAGTCCCCTTATTTAAGCATATTATTTAGTTTCATGAGGA
GAGGAGTCAATTAATGTTGATCTTGAGGTTAACAATGCATGTCTCGGTATAGGTTGACGTGAATGGTAAGAATGCTGCTCCAATTTACAAGTTCTTGAAGTCTAACAAGGGTGGACTTTT
TGGGGACAGCATCAAATGGAACTTTTCCAAGTTCCTGGTGGATAAAGATGGCAAAGTTGTGGATCGTTATGCTCCCACTACTTCCCCTCTTAGCATTGAG
GTAAGATCTGGTTCCGCCAT
ACATTCCCCCATATCCAGCTACTACATTTGATTTCGGATGTCTAATTTGTAACTGATATGATCCTGGTCATTGTTACTCTCTGCAGAAAGATGTCAAGAAACTACTGGGGATTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGCCAATCCAGTGCTCAATCAGTTCATGATTTCACTGTTAAGGATGCTAGGGAAAATGATGTTGACCTCAGCATATATAAGGGGAAGGTCCTCTTGATTGTCAATGTTGCTTCA
CAATG
TGGCTTGACCAATTCAAACTACACGGAGTTGACCCAGCTATATGACAAATACAGGGATCAAGGTTTGGAGATTCTGGCTTTTCCATGCAATCAGTTTGGATCTCAGGAGCCAGGG
AACAATGAACAAATAGTGGAGTTTGCTTGTACTCGCTTTAAGGCTGACTATCCCATATTTGATAAG
GTTGACGTGAATGGTAAGAATGCTGCTCCAATTTACAAGTTCTTGAAGTCTAAC
AAGGGTGGACTTTTTGGGGACAGCATCAAATGGAACTTTTCCAAGTTCCTGGTGGATAAAGATGGCAAAGTTGTGGATCGTTATGCTCCCACTACTTCCCCTCTTAGCATTGAG
AAAGAT
GTCAAGAAACTACTGGGGATTGCTTAA

Retrieve as FASTA