Entry information : PtGPx06-1 (POPTR_0001s09270 / PtGPx06-1)
Entry ID 2886
Creation 2006-03-20 (Felipe Teixeira)
Last sequence changes 2006-03-20 (Felipe Teixeira)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtGPx06-1 (POPTR_0001s09270 / PtGPx06-1)
Name (synonym) PtGPx06-1 (POPTR_0001s09270 / PtGPx06-1)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtGPx06-1
start..stop
S start..stop
PtGPx06-2 320 3e-113 1..168 71..238
MdGPx06 311 4e-111 1..168 1..168
VvGPx06 311 1e-110 1..168 1..168
GhGPx06-2 308 7e-110 1..166 1..166
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7088142..7088189 48 N° 2 7088653..7088729 77 N° 3 7089067..7089128 62 N° 4 7089411..7089529 119
N° 5 7089755..7089922 168 N° 6 7090029..7090061 33  
join(7088142..7088189,7088653..7088729,7089067..7089128,7089411..7089529,7089755 ..7089922,7090029..7090061)


exon

Literature and cross-references PtGPx06-1 (POPTR_0001s09270 / PtGPx06-1)
Literature JGI.
DNA ref. Phytozome 11:   scaffold_1 (7088142..7090061)
EST ref. GenBank:   DT486858
Cluster/Prediction ref. JGI gene:   709364 UniGene:   Pth.4729
Protein sequence: PtGPx06-1 (POPTR_0001s09270 / PtGPx06-1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18608.47  
PI (pH):   %s   7.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASQSSAQSVHDFTVKDARENDVDLSIYKGKVLLIVNVASQCGLTNSNYTELTQLYDKYRDGLEILAFPCNQFGSQEPGNNEQIVEFACTRFKADYPIFDVDVNGKNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKDGKVVDRYAPTTSPLSIEKDVKKLLGIA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 63 ESTs. Tamdem with PtGPx08. Unigene Pth.4729 compiles ESTs from PtGPx06-1 and -2.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGCCAATCCAGTGCTCAATCAGTTCATGATTTCACTGTTAAGGTAATTTTTTGTTGTATTTTATTTATGGTTTTTCTCTCAGTCTTTCTCAATAAAGTTGCTCGCTTGATGCTG
ATATTGAGGTTTTGGTATCATAACTGGCTTTTATTTTCCTTTTTTGTTTGTTTGATTTGAACGGTGCTTAATAGTAGTCTAATCATTTGTTTTGCTGCTGGAAATTTAGAGGATCTCTTT
AATTGTTGTTAAGGGGGGAAAAAGGACTAAAATGGTTTTTTATGCAAGGAAGGTCTTATTTCTTAAGGTTGTTGAGGTGGTACGAACTAGCATAATTTCAATCTGTGGATGTGCGGCTTA
TTGGCTGTTTCTCTGTTACCACTGAACCATCTGGATGTGCGGCTTATTGGCTGTTTCTCTGTTACCACTGAACCATCTAATGTATTAACTATGATTCCTCTGTGTTCTACTTATATTTAT
ATATAATGCCTTGGTTCTCTCTTGACTGTAGGATGCTAGGGAAAATGATGTTGACCTCAGCATATATAAGGGGAAGGTCCTCTTGATTGTCAATGTTGCTTCACAATGGTAATTCATTTC
GTCCCTTTTCATCTGTCCTTAACGGGAAGAGACTGAGGGGTTTTCTGGTTTTTATTAAAGAGATGTCCATTTCTTTTAAGGATAACTATGCTGTAAGATAATGCTCCTCGACTCAGTTCC
AATCTCCCTGGACTAATAATTAGTGTGCCACAGGGTTTCGTCAGTGAGTTCACTCCTCATTTTGTTGAAATCACAGAGCGTGAAGTGAACTCATAAGTTGGGAAATAAGGGTGAAGAATC
CCTTTCAATTGAAAGAGGATCCTTCTTCACCATCTCTTAGACAGGAGTTTATTGTTTACTTCTCTAACCTTTAATTTTGGTGCAGTGGCTTGACCAATTCAAACTACACGGAGTTGACCC
AGCTATATGACAAATACAGGGATCAAG
GTAAACTTCTATTATATTTTATGTTTTGTGTTGTGGCACTTAAATGTTTACTGACTTGTATGTGGCTTTTTTTTCATGAGTTAGCTTCTGCTG
TAGGAATATATGAACCCCTATTAGTCACTAGCTGGGCTGCTACATGGGTTTGCCTGTATCTTTCTGATGACTTTTTGCGAATTTCAACTTCGTATCTAATTGATTGGCATGGCTAAACCT
TGCAAGTCATTGCCATCTTGCTGTAATGCCCGTTCTTTTTTCTTATCACTTGCCTTTGTGCTGATGCAGGTTTGGAGATTCTGGCTTTTCCATGCAATCAGTTTGGATCTCAGGAGCCAG
GGAACAATGAACAAATAGTGGAGTTTGCTTGTACTCGCTTTAAGGCTGACTATCCCATATTTGATAAG
GTATGCTAACTCTGAGATTTTACAGCCTGATGAAGATGGATTTCTTAATTTA
TAATCAATTTTCTTTCTCGCATGACTGCCAAAATTTTCCCACCATTTCATGTTTGAGTTTTTGATGAACATTCAATAATTGAAGTCCCCTTATTTAAGCATATTATTTAGTTTCATGAGG
AGAGGAGTCAATTAATGTTGATCTTGAGGTTAACAATGCATGTCTCGGTATAGGTTGACGTGAATGGTAAGAATGCTGCTCCAATTTACAAGTTCTTGAAGTCTAGCAAGGGTGGACTTT
TTGGGGACAGCATCAAATGGAACTTTTCCAAGTTCCTGGTGGATAAAGATGGCAAAGTTGTGGATCGTTATGCTCCCACTACTTCCCCTCTTAGCATTGAG
GTAAGATCTGGTTCCGCCA
TACATTCCCCCATATCCAGCTACTACATTTGATTTCGGGTGTCTAATTTGTAACTGATATGATCCTGGTCATTGTTACTCTCTGCAGAAAGATGTCAAGAAACTACTGGGGATTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGCCAATCCAGTGCTCAATCAGTTCATGATTTCACTGTTAAGGATGCTAGGGAAAATGATGTTGACCTCAGCATATATAAGGGGAAGGTCCTCTTGATTGTCAATGTTGCTTCA
CAATG
TGGCTTGACCAATTCAAACTACACGGAGTTGACCCAGCTATATGACAAATACAGGGATCAAGGTTTGGAGATTCTGGCTTTTCCATGCAATCAGTTTGGATCTCAGGAGCCAGGG
AACAATGAACAAATAGTGGAGTTTGCTTGTACTCGCTTTAAGGCTGACTATCCCATATTTGATAAG
GTTGACGTGAATGGTAAGAATGCTGCTCCAATTTACAAGTTCTTGAAGTCTAGC
AAGGGTGGACTTTTTGGGGACAGCATCAAATGGAACTTTTCCAAGTTCCTGGTGGATAAAGATGGCAAAGTTGTGGATCGTTATGCTCCCACTACTTCCCCTCTTAGCATTGAG
AAAGAT
GTCAAGAAACTACTGGGGATTGCTTAA

Retrieve as FASTA