Entry information : PtGPx06-2 (POPTR_0003s12620 / PtGPx06-2 / Potri.003G126100)
Entry ID 2887
Creation 2006-03-20 (Felipe Teixeira)
Last sequence changes 2006-03-20 (Felipe Teixeira)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtGPx06-2 (POPTR_0003s12620 / PtGPx06-2 / Potri.003G126100)
Name (synonym) PtGPx06-2 (POPTR_0003s12620 / PtGPx06-2 / Potri.003G126100)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtGPx06-2
start..stop
S start..stop
MdGPx06-2 325 2e-114 14..238 2..223
LuGPx220 323 2e-113 1..238 1..238
LuGPx46 323 2e-113 1..238 1..236
PtGPx06-1 320 4e-113 71..238 1..168
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13135568..13135825 258 N° 2 13136300..13136376 77 N° 3 13136651..13136712 62 N° 4 13136995..13137113 119
N° 5 13137290..13137457 168 N° 6 13137567..13137599 33  
join(13135568..13135825,13136300..13136376,13136651..13136712,13136995..13137113 ,13137290..13137457,13137567..13137599)


exon

Literature and cross-references PtGPx06-2 (POPTR_0003s12620 / PtGPx06-2 / Potri.003G126100)
Literature JGI.
DNA ref. Phytozome 11:   scaffold_3 (13135568..13137599)
EST ref. GenBank:   DT496823
Cluster/Prediction ref. JGI gene:   350213 UniGene:   Pth.4729
Omic ref. ePlant:   Potri.003G126100
Protein sequence: PtGPx06-2 (POPTR_0003s12620 / PtGPx06-2 / Potri.003G126100)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   238
PWM (Da):   %s   26218.56  
PI (pH):   %s   9.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLTSRSRILSQKYLNFASLSASFLLSKQSSFNSKQTLLPSLHNSPVSLYSQSIKAGVSRRLLGSVRFNHSMASQSSPQSAHDFTVKDAKGNDVDLSIYKGKVLLIVNVASQCGLTDSNYTELTQLYAKYKDGLEILAFPCNQFGSQEPGSSEEIVEFACTRFKAEYPIFDVEVNGNNAAPIYKYLKSSKGGLFGDNIKWNFSKFLVDKEGKVVDRYAPTTSPLSIEKEVKKLLGIA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 63 ESTs. Unigene Pth.4729 compiles ESTs from PtGPx06-1 and -2.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCACTTCTCGCTCTCGCATTCTCTCTCAAAAATATCTCAACTTTGCATCGTTATCTGCTTCTTTCTTATTATCAAAACAGTCATCTTTCAATTCCAAGCAAACCCTTTTGCCATCT
TTGCATAACTCGCCAGTTTCTTTATATTCTCAGTCAATCAAAGCAGGGGTTTCAAGGCGTTTATTGGGTTCTGTAAGATTCAATCATTCAATGGCAAGCCAATCCAGTCCTCAATCTGCT
CATGATTTCACTGTTAAG
GTGGCTTTTTCAGTGTTTTAATTATGGTTTTTTTTTCGCCTTTTAGTTTTTGTCTATAAAGTTGCTTGCTTTATGCTGATCTTGAGGTTCGGGTACCATAAC
TTTCTTGGTTCTGGGTTGTGTTTGTGTGATTTGAACGGTGCTTAATTGTAGTCTGATCTTTTTTTTGGCTGCTGGAAATTGAGAGGATTACTGTAATTGTTATTAAGAAAAAATGAGGCC
CTAGGTTGGTTTGTTGGCAAGGAAGGTCTTTTTTTTTTTTTTAAGGTTGCTGAGGTGGCAAGAACTTGTGTAATTTGATGGTGTTAAAGAATATGGAGGGTGTCTTTTAATTTTGTTCCT
TTTGAGTTTTTCAATCTGTGTATGTTTTAGTTATTTGCCATTTATCTGTTGCTATTGGACCATCGAATGTATTATCTTTGATTCTTATGTACGACTTATCTATATCTCTCCTATGCCAAA
TCTTGATTGTAGGATGCTAAGGGAAATGATGTTGACCTCAGCATTTATAAGGGGAAGGTCCTCTTGATTGTCAATGTTGCTTCACAATGGTAATTCATTTCCCTACTTTTCATTTGTCCT
CGATGGGAAGAGGTTGAAGGGTTTTCTGGCTCTTATTACCTTTTTATTAAAGAGACGCTCCTTGACATAGTTCCAATCAAAATCCTTACTGTTGCAACATCAGTGTTAGTCGGTGGGTTC
ACTCCTCACGGATTCACTTTGCTGAAATCCTGTCGCAAAACAAGAGTGCACGAATGTAAACTCATTTAAGTTTGGAAATAAGGAGTCCACTGTTTACTTCTATGACCTTTAATTTTAATG
CAGTGGCTTGACCGATTCAAACTACACGGAGCTGACCCAGCTATATGCAAAATACAAGGATCAAGGTCAGATTCTATCTTGTTTTGTGTTGTGGCACTTAAGTTTGTAGACTTGCAAGTA
TTTTTTTCATAAGTTAGCTTCTGCATTAGGAACCAATGAACCCCTATTAGTGTACTAGATGGGTTAGTATATGGGTTTGCCTGTATCTTTGGATGGCTTCTATATGTTTCCTTGTGAAGT
TCAATTGGGAATCAAATTGCTTGACATGGCTAATCATTTCAAGTCATTGCCATTTTTTGCTGTATGACTGTTCCTTTCTCTGATTGCTTGCCTTTGTACTGATGCAGGTTTGGAGATTCT
GGCTTTTCCGTGCAATCAATTTGGATCTCAGGAGCCTGGGAGCAGTGAAGAGATTGTGGAGTTTGCTTGCACTCGCTTTAAGGCTGAATATCCCATATTTGATAAG
GTAAGCTAACTCTT
GCCATTTTACAGCCAGATGAAAATGGATTTCTTAATTTGTAATCAGTTTTCTTTCTGACATGGCTGCCAAAAATTTTCCACCTGGTAATGTTCGTGTCTTTGGTGAACATTGTCAATGAA
TCAAAGTTCACTTTCTTAAGAAGCGTGTTATTCTTGGTATAGGTTGAAGTGAATGGTAACAACGCTGCTCCAATTTACAAATACTTGAAGTCTAGCAAGGGTGGACTTTTTGGGGACAAC
ATTAAATGGAATTTTTCCAAGTTCCTGGTAGATAAAGAAGGCAAAGTTGTGGATCGTTATGCTCCCACTACCTCCCCTCTTAGCATTGAG
GTAAAATTTGGTTCTGGTATTTCATTCCCC
ATATTCAGCGACTACATTTGATTTCAGATGTCTGATTAGTAACTTATATGATCCTGGTCAATATCGTTACTCTCTGCAGAAAGAGGTGAAGAAACTTCTGGGGATTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCACTTCTCGCTCTCGCATTCTCTCTCAAAAATATCTCAACTTTGCATCGTTATCTGCTTCTTTCTTATTATCAAAACAGTCATCTTTCAATTCCAAGCAAACCCTTTTGCCATCT
TTGCATAACTCGCCAGTTTCTTTATATTCTCAGTCAATCAAAGCAGGGGTTTCAAGGCGTTTATTGGGTTCTGTAAGATTCAATCATTCAATGGCAAGCCAATCCAGTCCTCAATCTGCT
CATGATTTCACTGTTAAG
GATGCTAAGGGAAATGATGTTGACCTCAGCATTTATAAGGGGAAGGTCCTCTTGATTGTCAATGTTGCTTCACAATGTGGCTTGACCGATTCAAACTACACG
GAGCTGACCCAGCTATATGCAAAATACAAGGATCAAG
GTTTGGAGATTCTGGCTTTTCCGTGCAATCAATTTGGATCTCAGGAGCCTGGGAGCAGTGAAGAGATTGTGGAGTTTGCTTGC
ACTCGCTTTAAGGCTGAATATCCCATATTTGATAAG
GTTGAAGTGAATGGTAACAACGCTGCTCCAATTTACAAATACTTGAAGTCTAGCAAGGGTGGACTTTTTGGGGACAACATTAAA
TGGAATTTTTCCAAGTTCCTGGTAGATAAAGAAGGCAAAGTTGTGGATCGTTATGCTCCCACTACCTCCCCTCTTAGCATTGAG
AAAGAGGTGAAGAAACTTCTGGGGATTGCTTAA

Retrieve as FASTA