Entry information : PtGPx06-2(POPTR_0003s12620 / PtGPx06-2 / Potri.003G126100)
Entry ID 2887
Creation 2006-03-20 (Felipe Teixeira)
Last sequence changes 2006-03-20 (Catherine )
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-04-21 (Catherine )
Peroxidase information: PtGPx06-2(POPTR_0003s12620 / PtGPx06-2 / Potri.003G126100)
Name PtGPx06-2(POPTR_0003s12620 / PtGPx06-2 / Potri.003G126100)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtGPx06-2
start..stop
S start..stop
MdGPx06-2 325 4e-114 14..238 2..223
LuGPx220 325 4e-114 1..238 1..238
LuGPx46 324 1e-113 1..238 1..236
ThasGPx06-2 322 1e-112 47..237 49..239
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14695717..14695974 258 N° 2 14696448..14696524 77 N° 3 14696799..14696860 62 N° 4 14697143..14697261 119
N° 5 14697438..14697605 168 N° 6 14697715..14697747 33  
join(14695717..14695974,14696448..14696524,14696799..14696860,14697143..14697261 ,14697438..14697605,14697715..14697747)


exon

Literature and cross-references PtGPx06-2(POPTR_0003s12620 / PtGPx06-2 / Potri.003G126100)
Literature JGI.
DNA ref. Phytozome 12:   Chr3 (14695717..14697747)
EST ref. GenBank:   DT496823
Cluster/Prediction ref. JGI gene:   350213 UniGene:   Pth.4729
Omic ref. ePlant:   Potri.003G126100
Protein sequence: PtGPx06-2(POPTR_0003s12620 / PtGPx06-2 / Potri.003G126100)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   238
PWM (Da):   %s   26192.55  
PI (pH):   %s   9.71
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLTSRSRILSQKYLNFASLSASFLLSKQSSFNSKQTLLPSLHNSPVSLHSQSIKAGVSRRLLGSVRFNHSMASQSSPQSAHDFTVKDAKGNDVDLSIYKGKVLLIVNVASQCGLTDSNYTELTQLYAKYKDGLEILAFPCNQFGSQEPGSSEEIVEFACTRFKAEYPIFDVEVNGNNAAPIYKYLKSSKGGLFGDNIKWNFSKFLVDKEGKVVDRYAPTTSPLSIEKEVKKLLGIA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 63 ESTs. Unigene Pth.4729 compiles ESTs from PtGPx06-1 and -2.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCACTTCTCGCTCTCGCATTCTCTCTCAAAAATATCTCAACTTTGCATCGTTATCTGCTTCTTTCTTATTATCAAAACAGTCATCTTTCAATTCCAAGCAAACCCTTTTGCCATCT
TTGCATAACTCACCAGTTTCTTTACATTCTCAGTCAATCAAAGCAGGGGTTTCAAGGCGTTTATTGGGTTCTGTAAGATTCAATCATTCAATGGCAAGCCAATCCAGTCCTCAATCTGCT
CATGATTTCACTGTTAAG
GTGGCTTTTTCAGTGTTTTAATTATGGTTTTTTTTTCGCCTTTTAGTTTTTGTCTATAAAGTTGCTTGCTTTATGCTGATCTTGAGGTTCGGGTACCATAAC
TTTCTTGGTTCTGGGTTGTGTTTGTGTGATTTGAACGGTGCTTAATTGTAGTCTGATCTTTTTTTTGGCTGCTGGAAATTGAGAGGATTACTGTAATTGTTATTAAGAAAAAATAAGGCC
TAGGTTGGTTTGTTGGCAAGGAAGGTCTTTTTTTTTTTTTTAAGGTTGCTGAGGTGGCAAGAACTTGTGTAATTTGATGGTGTTAAAGAATATGGAGGGTGTCTTTTAATTTTGTTCCTT
TTGAGTTTTTCAATCTGTGTATGTTTTAGTTATTTGCCATTTATCTGTTGCTATTGGACCATCGAATGTATTATCTTTGATTCTTATGTACGACTTATCTATATCTCTCCTATGCCAAAT
CTTGATTGTAGGATGCTAAGGGAAATGATGTTGACCTCAGCATTTATAAGGGGAAGGTCCTCTTGATTGTCAATGTTGCTTCACAATGGTAATTCATTTCCCTACTTTTCATTTGTCCTC
GATGGGAAGAGGTTGAAGGGTTTTCTGGCTCTTATTACCTTTTTATTAAAGAGACGCTCCTTGACATAGTTCCAATCAAAATCCTTACTGTTGCAACATCAGTGTTAGTCGGTGGGTTCA
CTCCTCACGGATTCACTTTGCTGAAATCCTGTCGCAAAACAAGAGTGCACGAATGTAAACTCATTTAAGTTTGGAAATAAGGAGTCCACTGTTTACTTCTATGACCTTTAATTTTAATGC
AGTGGCTTGACCGATTCAAACTACACGGAGCTGACCCAGCTATATGCAAAATACAAGGATCAAGGTCAGATTCTATCTTGTTTTGTGTTGTGGCACTTAAGTTTGTAGACTTGCAAGTAT
TTTTTTCATAAGTTAGCTTCTGCATTAGGAACCAATGAACCCCTATTAGTGTACTAGATGGGTTAGTATATGGGTTTGCCTGTATCTTTGGATGGCTTCTATATGTTTCCTTGTGAAGTT
CAATTGGGAATCAAATTGCTTGACATGGCTAATCATTTCAAGTCATTGCCATTTTTTGCTGTATGACTGTTCCTTTCTCTGATTGCTTGCCTTTGTACTGATGCAGGTTTGGAGATTCTG
GCTTTTCCGTGCAATCAATTTGGATCTCAGGAGCCTGGGAGCAGTGAAGAGATTGTGGAGTTTGCTTGCACTCGCTTTAAGGCTGAATATCCCATATTTGATAAG
GTAAGCTAACTCTTG
CCATTTTACAGCCAGATGAAAATGGATTTCTTAATTTGTAATCAGTTTTCTTTCTGACATGGCTGCCAAAAATTTTCCACCTGGTAGTGTTCGTGTCTTTGGTGAACATTGTCAATGAAT
CAAAGTTCACTTTCTTAAGAAGTGTGTTATTCTTGGTATAGGTTGAAGTGAATGGTAACAACGCTGCTCCAATTTACAAATACTTGAAGTCTAGCAAGGGTGGACTTTTTGGGGACAACA
TTAAATGGAATTTTTCCAAGTTCCTGGTAGATAAAGAAGGCAAAGTTGTGGATCGTTATGCTCCCACTACCTCCCCTCTTAGCATTGAG
GTAAAATTTGGTTCTGGTATTTCATTCCCCA
TATTCAGCGACTACATTTGATTTCAGATGTCTGATTAGTAACTTATATGATCCTGGTCAATATCGTTACTCTCTGCAGAAAGAGGTGAAGAAACTTCTGGGGATTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCACTTCTCGCTCTCGCATTCTCTCTCAAAAATATCTCAACTTTGCATCGTTATCTGCTTCTTTCTTATTATCAAAACAGTCATCTTTCAATTCCAAGCAAACCCTTTTGCCATCT
TTGCATAACTCACCAGTTTCTTTACATTCTCAGTCAATCAAAGCAGGGGTTTCAAGGCGTTTATTGGGTTCTGTAAGATTCAATCATTCAATGGCAAGCCAATCCAGTCCTCAATCTGCT
CATGATTTCACTGTTAAG
GATGCTAAGGGAAATGATGTTGACCTCAGCATTTATAAGGGGAAGGTCCTCTTGATTGTCAATGTTGCTTCACAATGTGGCTTGACCGATTCAAACTACACG
GAGCTGACCCAGCTATATGCAAAATACAAGGATCAAG
GTTTGGAGATTCTGGCTTTTCCGTGCAATCAATTTGGATCTCAGGAGCCTGGGAGCAGTGAAGAGATTGTGGAGTTTGCTTGC
ACTCGCTTTAAGGCTGAATATCCCATATTTGATAAG
GTTGAAGTGAATGGTAACAACGCTGCTCCAATTTACAAATACTTGAAGTCTAGCAAGGGTGGACTTTTTGGGGACAACATTAAA
TGGAATTTTTCCAAGTTCCTGGTAGATAAAGAAGGCAAAGTTGTGGATCGTTATGCTCCCACTACCTCCCCTCTTAGCATTGAG
AAAGAGGTGAAGAAACTTCTGGGGATTGCTTAA

Retrieve as FASTA