Entry information : PtGPx05 (POPTR_0014s13490)
Entry ID 2888
Creation 2006-03-20 (Felipe Teixeira)
Last sequence changes 2006-03-20 (Felipe Teixeira)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtGPx05 (POPTR_0014s13490)
Name (synonym) PtGPx05 (POPTR_0014s13490)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtGPx05
start..stop
S start..stop
EgrGPx09 295 2e-104 1..169 1..169
EguGPx09 293 1e-103 1..169 1..169
GhGPx05 290 3e-102 1..168 1..168
GaGPx05 288 6e-102 1..168 1..168
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9933293..9933346 54 N° 2 9933450..9933526 77 N° 3 9933618..9933679 62 N° 4 9933793..9933911 119
N° 5 9935920..9936087 168 N° 6 9936179..9936211 33  
join(9933293..9933346,9933450..9933526,9933618..9933679,9933793..9933911,9935920 ..9936087,9936179..9936211)


exon

Literature and cross-references PtGPx05 (POPTR_0014s13490)
Literature JGI.
DNA ref. Phytozome 11:   scaffold_14 (9933293..9936211)
EST ref. GenBank:   DT476192
Cluster/Prediction ref. JGI gene:   731984 UniGene:   Pth.1708
Protein sequence: PtGPx05 (POPTR_0014s13490)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   18833.66  
PI (pH):   %s   9.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSSPSVPEKSIHEFTVKDNRGQDVNLGIYKGKVLLVVNVASKCGFTDSNYTQLTDLYKNYKDGLEILAFPCNQFLNQEPGTSEDAQNFACTRYKADYPIFHVRVNGPNAAPVYKFLKASKPGFLGNRIKWNFTKFLVDKDGHVLGRYSTITAPMAIEADIKKALGEM*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 24 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTCTTCTCCATCGGTACCAGAGAAATCAATCCATGAATTCACTGTCAAGGTAATAAAATAAAATATTATGTTTATAGATTGATTGATTGCTTGTTGATTCATGGGTTTCTTTTTA
AAAAATAATAATAAATTTTGATGTGAATTACTTTCAGGATAACAGAGGTCAGGACGTGAACCTTGGTATCTATAAAGGGAAGGTTCTTCTTGTGGTTAACGTCGCCTCTAAATGGTTTGT
TTTTGTTTCTTTTTTGTTCTTCGTCTTCTAGGGAATGGAATTACTCGAAACTTCATTATTGATTTCTTCTTGTTGTTTGGAACAGTGGATTTACAGATTCAAATTACACCCAGTTGACTG
ATCTTTATAAAAATTACAAGGACAAAG
GTTTGTGTTTCTAAATTAATGCTATGTTTTCACCCAGATTTTTTTTTTGTGTGGAGAAAGCTGCTGTGATGAAAAATAAAATAAAATGATTTA
ATGTCTTGTGATGCTGTCAGGTTTGGAAATCTTGGCGTTTCCATGTAACCAGTTTTTGAATCAAGAGCCTGGGACAAGCGAGGATGCTCAAAACTTTGCTTGTACTAGGTACAAGGCTGA
CTATCCAATTTTCCACAAG
GTAATGAATGGACTTGGACTTGTTATTGCAGTAGGATGTTATCTCCTCCATAGTTGTTCTCGACATTTCACCCCTTCTAGTTTGCCAAATGTCCATTTCGC
TCCATGCAGTTGCCATGTCCTTGTGTTAAGCGCATTGTTGCAGTTACAATCCACCCAGTTTAATTTCTAACAGGCCTAAATGGAGCCCTTTTTTTATATTTAATTTTCCTATTTATCCCC
AAAAGAAGATTTGTTGTGGCCAACATGGCTAATCGTTATTTCTCCCACAACAGTGGTGCCGTAGGTTCATTGGCTATTTAAATGCATGGGTTGACATTAGACCAGAGGGACCGGAGTGGA
ACATTTGGCACTATATTCTCCAAATTTTTAGCTAGTCTTTTGCATTATGTTGCTACTTGTTGATCAACGAAGGTAGTTAATGCTGCCTTCTAAGTTGATCTCAAGTGCCTGTGATTATCT
TCTATCTGGTTATAAGATGATGCTAGAAGTTCATTCATTTCTGTAAAAGATTGTTATAACTCTTTTTTACCAATGCATTCTCTCTTAGGTTAAGTTATTTTGCTTCCTAGAAATTACTGT
TTATGCGATTGATTGTAGCTGGTTTAGCTATCTATTGAGAGTTAATGAAGATCTATGAATTCCATATAGATCAGAGGCAAGCTTAGCAAACACTACTTTTTCATACCACTACAGAGGTAG
AAGGTCTTTAACTTTCTCTACCACTAAGGCCATTATGAAAGACTTAGGAATCACTGTTTTTCATAAGGAGACGCTGACGACTCTAGACTGCAGGGGCGCATGGTATTGTTTGATGTGGAA
GCGCCTGTCCCAGTATTAGCAGATTGAATGTGAGCCTAGAGTCTAAATGCATTAGAAATGGGGTTGGCCAGTGGCCAATGATGAAGAGATATTGATTTGGAAGTGAATTGGTCAATTCTG
CTACTTCCTTGTTGGGAAGCACCCTTGAGAGGTTCTGTGGGAGGCAAGTGGCCATATGTTTGATTGGAGAGCTGAGAGCTGATTCACCCAAGAAACAAGCATTTTATTTTTATTTTTAAT
GATATTTTCAATAGGGGTATTTCTGAATTCCCGACTTCATCCCATGCACTGAATTGGATGGCCCTTGGTTGGCATTTATTGGGACATGGAAACCTTTTACAGTGTATAGGTTGCAAATTA
AATTGATCACGGAACTTCTGCCTGCATTTGTTTACCATTTGAGAAAAATGGGCTGGTAATGGAAGGGGTTTAAAGCTGAACTGCTGCACTTACATCCTTGTCATGTTTTGGTTCTTTGAG
AGGCGCAAAGATATGTGGTCTACAATACTCCATCAAGTGACAAAAAGTGGAACTGAAAATATTGGGAAATACTTGTTTTGACACTTTAAATTAGACATACATAGATGTTTAATCAGTAAT
TAGATTTTTTTTTTCTCCTGAAGTTCGGTGAATTCAAGATTTGTACAAGGGTCATGTTAAGAAATTAGGAGCATGTTTTTATTGTATAGGCTGTTAATCTTTGTCAATATCAGAAGTTAC
AAGGGTTAGTATAGTAGCAATTTACAGTTATCTAGAATCGCTAGAATGTGTAGGATGCAGTAAAAGACGACAAATTCAAAAAGGAAAATGAATATGCTAGTTGAAGTAGAATTCATGGAT
TGTGTTGGGTATAGTAGCAATTTACAGTTATCTAGAATTGCTAGAATGTGTAGGATGCAGTAAAAGACGACAAATTCAAAAAGGAAAATGAATATGCTAGTTGAAGTAGAATTCATGGAT
TGTGTTGGCATTCAAGAAGTCCATTTCTGATTTTATAAGATTTTAAACCTGATGTCTAAGTGATTGCTTGTCAATCATCATATTTGTGAGAGATACTTAACTGTGCTTTTCATGTGACCA
TAAATTATACAGCTTACCAACTATGGATCTTCAGTTAGAAGTAGTTGATTTTGCTCTTTGGAACGTACTTATTTAATACTAGATTCTCAACTCTCTGCTGCATCTAGGTTCGTGTTAATG
GACCAAATGCTGCACCTGTATACAAGTTCCTCAAGGCAAGTAAACCTGGATTTCTGGGAAATAGGATAAAGTGGAATTTTACCAAGTTCTTGGTTGACAAGGACGGGCATGTCCTTGGTC
GCTATAGCACAATCACTGCTCCTATGGCCATTGAG
GTTCCTCCCTCCCTCCCTCCCTCCCTCTCTCTCTAGCAAACATGTTATTCATAAAATTCACACTCAGTTTTGCTTTGTTTTTTGG
GAACAGGCTGATATCAAGAAAGCACTGGGAGAGATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTCTTCTCCATCGGTACCAGAGAAATCAATCCATGAATTCACTGTCAAGGATAACAGAGGTCAGGACGTGAACCTTGGTATCTATAAAGGGAAGGTTCTTCTTGTGGTTAACGTC
GCCTCTAAATG
TGGATTTACAGATTCAAATTACACCCAGTTGACTGATCTTTATAAAAATTACAAGGACAAAGGTTTGGAAATCTTGGCGTTTCCATGTAACCAGTTTTTGAATCAAGAG
CCTGGGACAAGCGAGGATGCTCAAAACTTTGCTTGTACTAGGTACAAGGCTGACTATCCAATTTTCCACAAG
GTTCGTGTTAATGGACCAAATGCTGCACCTGTATACAAGTTCCTCAAG
GCAAGTAAACCTGGATTTCTGGGAAATAGGATAAAGTGGAATTTTACCAAGTTCTTGGTTGACAAGGACGGGCATGTCCTTGGTCGCTATAGCACAATCACTGCTCCTATGGCCATTGAG
GCTGATATCAAGAAAGCACTGGGAGAGATGTGA

Retrieve as FASTA