Entry information : OsGPx03 (Os02g0664000)
Entry ID 2891
Creation 2006-03-20 (Marcia Pinheiro Margis)
Last sequence changes 2006-03-20 (Marcia Pinheiro Margis)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsGPx03 (Os02g0664000)
Name (synonym) OsGPx03 (Os02g0664000)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation Mitochondria
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsGPx03
start..stop
S start..stop
TaGPx03-1A 363 3e-129 1..238 1..237
ZmGPx03 354 1e-125 1..238 1..246
SbGPx03 350 1e-123 1..237 1..247
HvGPx03 344 8e-122 1..238 1..237
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26948263..26948520 258 N° 2 26948831..26948907 77 N° 3 26949597..26949658 62 N° 4 26949797..26949915 119
N° 5 26950326..26950493 168 N° 6 26950587..26950619 33  
join(26948263..26948520,26948831..26948907,26949597..26949658,26949797..26949915 ,26950326..26950493,26950587..26950619)


exon

Literature and cross-references OsGPx03 (Os02g0664000)
Literature Sasaki T., Matsumoto T., Katayose Y. Oryza sativa nipponbare(GA3) genomic DNA, chromosome 2, PAC clone:P0461B08.
Protein ref. GenPept:   BAD28380 UniProtKB:   Q6ESJ0 UniProtKB_Uniparc:   A3A9W1 [Other strain]
DNA ref. GenBank:   NC_008395.1 (26948263..26950616)
Cluster/Prediction ref. UniGene:   Os.4833
Protein sequence: OsGPx03 (Os02g0664000)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   238
PWM (Da):   %s   25735.37  
PI (pH):   %s   9.89
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSRTAPFISRLRLLRTAAALSPFSSSAPPRHSPRILRAIPVGAPHPPRVSAAVSPLVRPVAAGFALFSMATAASSAASVHDFTVKDASGKDVDLSTFKGKVLLIVNVASQCGLTNSNYTELSQLYEKYKDGFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDVDVNGDNTAPIYKFLKSSKGGLFGDNIKWNFSKFLVDKEGRVVERYAPTTSPLSMEKDIKKLLGSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 5 introns), 4 cDNA and 47 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGTCTCGCACCGCCCCGTTCATCTCTCGCCTCCGGCTCCTCCGAACCGCCGCCGCCCTCTCCCCGTTCTCGTCCTCCGCGCCGCCGCGGCACAGCCCCCGCATCCTCCGCGCTATC
CCTGTCGGTGCGCCTCACCCGCCGCGCGTCTCCGCAGCCGTCTCGCCGCTGGTCCGTCCGGTCGCCGCCGGGTTCGCGCTGTTCAGCATGGCCACCGCCGCCTCCTCCGCCGCATCCGTC
CACGACTTCACCGTCAAG
GTCTGCACTGCCTCCTGCCCTCCTCAAAACTTGGACACCCCTTTCCCCTCTGGTGATTTGGTCCCCTTTCAGCAGCGAGAGACTGAAGCTTTATACCCATAC
CCCATACCCCTCTGGGGGAAAGTATTTGCACATCGATGCCTCCGTGATGCTGCTACGATTCGGCCCTTTTGGGACTTCTTAAGCCAATATCTTTTTGGTTTTAGCTGCAGATTTTTTTAC
CCAAATCTTTGGAGGTTTTCTACAAGCTGTTATACTGCTTGAATTGTGATCCTAATGTTTAAAGGACTATGCTTTTTGGTGTTTGCAGGATGCAAGTGGCAAAGATGTGGACCTGAGCAC
CTTCAAGGGGAAAGTCCTCCTTATCGTCAATGTTGCATCTCAGTG
GTACCAATTATTACCAATCCCTCACCTCCACAGTGTCTACGTTTTAATTTTGTAAACTTGGAAATTATTCTAGAA
TGCATAATGTGATTTATCTTTTTCATGTTGAAATGTTCCATGAACAACGAAACCTTGGAACCCTAGTACTGCGTTATCAAGCGCTTAAGTTGAATGATATGCTCATTTGATGCCTAATAT
AATGTATATTTTCGATCAAACTTCCATTCATGTTGCAAAGTAAAGATGCCGAATTTATATGGTTTCATATGGAACACATTCGAGTTTCTATCTAGGCCATATGAGACAAATCGAAATTTG
AAGTATTGTTCTGCTAAATGAAACTTTAAAAAGAGCCATGGTAGTGTTTGTCCCGGAGGATCAGCCTTTGCATGTAGATTATCGATATATGGAAAAAATAATAATCTGGTCAGCAGGTAA
GTTGGTTTTAGCTGGACAACAGGATGTTGATCTCTTGCCAATTGGAAAGTTTGTGCAGATTGTCATACCATTAACTATTTTTCTATTTGCGTCTCATCCTCCTTGTGTTAAGGGATACAT
GTTCTTTAGAGGACGGCCATTTTTTTTTTACTAATTTTAAAGACCAATGAGATGCAGATATAATAAAATAACATACAAACTGATATCATTATCCTCAAATTAAGAAATCTTGTTGCTCTC
TGTCATTGTTGCAGTGGCTTGACCAATTCCAACTACACGGAGCTGAGCCAGTTGTATGAGAAGTACAAGGACCAGGGTGAGTGTTAGATGCATCTCATCATTTGTTCCCTCATTATGAAA
TCTCTCTTGTGCGCTGAATTGCTCATATGTTCTTTCATTTGGAGTTTATGACCAACCAATTGCTAATGTCATTGTCAATTTGATTTGACGACAGGTTTTGAGATCCTTGCTTTCCCATGC
AACCAGTTTGGTGGACAGGAACCTGGCACTAATGAGGAGATTGTCCAATTTGCTTGCACCCGCTTCAAGGCCGAGTATCCAATTTTTGATAAG
GTAAATTTGGGCACATTATACCACTAC
CTCTTGCATTTTTGCACTTTTTTTTTCATTTATCTTTCAAGCGGAAAGAAACAACTAACTCAAGTATATGTTCACCTTCCAGAGCCGTCATAATATTTTAAAGGAAATTAATCCCATTCC
GAAAGTGTTCCCTTTCATATGTAGCCTGTGATGTATTTCCAGATACTTGTCTAGTACTTAAAAGGAAATTGATCAAGTCCATGAAGTTTTTATCCGATTCTTATGCATTTCGTATGATGT
ATGCGATCGATAAGCCTGATACCAGTTTTATCCTTTCATTTATCACAAGAAAGAATCATGGATGTTTATAATGTGATGATCAATTGATTTTTATTGTTTAGAGAGGTGAGATCTAGAAGT
TCTAACTACCATTATCTTAATAGGTTGATGTTAATGGTGACAACACTGCACCCATCTACAAGTTTCTGAAGTCCAGCAAAGGTGGTCTTTTCGGTGACAATATCAAATGGAACTTCTCCA
AGTTCTTGGTCGACAAAGAGGGGCGTGTTGTGGAGCGCTATGCGCCAACTACTTCTCCACTCAGCATGGAG
GTAAATCCCGAGCTCCAAGTGGGTGTAATTTGAGTTCCATCTCATCAAG
CTTCCTTGCCTTCACTTACAGCGATTGCTTTAATCATATTACAGAAGGACATCAAGAAGCTGCTTGGAAGTTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGTCTCGCACCGCCCCGTTCATCTCTCGCCTCCGGCTCCTCCGAACCGCCGCCGCCCTCTCCCCGTTCTCGTCCTCCGCGCCGCCGCGGCACAGCCCCCGCATCCTCCGCGCTATC
CCTGTCGGTGCGCCTCACCCGCCGCGCGTCTCCGCAGCCGTCTCGCCGCTGGTCCGTCCGGTCGCCGCCGGGTTCGCGCTGTTCAGCATGGCCACCGCCGCCTCCTCCGCCGCATCCGTC
CACGACTTCACCGTCAAG
GATGCAAGTGGCAAAGATGTGGACCTGAGCACCTTCAAGGGGAAAGTCCTCCTTATCGTCAATGTTGCATCTCAGTGTGGCTTGACCAATTCCAACTACACG
GAGCTGAGCCAGTTGTATGAGAAGTACAAGGACCAGG
GTTTTGAGATCCTTGCTTTCCCATGCAACCAGTTTGGTGGACAGGAACCTGGCACTAATGAGGAGATTGTCCAATTTGCTTGC
ACCCGCTTCAAGGCCGAGTATCCAATTTTTGATAAG
GTTGATGTTAATGGTGACAACACTGCACCCATCTACAAGTTTCTGAAGTCCAGCAAAGGTGGTCTTTTCGGTGACAATATCAAA
TGGAACTTCTCCAAGTTCTTGGTCGACAAAGAGGGGCGTGTTGTGGAGCGCTATGCGCCAACTACTTCTCCACTCAGCATGGAG
AAGGACATCAAGAAGCTGCTTGGAAGTTCTTAA

Retrieve as FASTA