Entry information : GmPrx88 (sEpb1 / Glyma01g36780.1)
Entry ID 290
Creation 2006-10-30 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx88 (sEpb1 / Glyma01g36780.1)
Name (synonym) GmPrx88 (sEpb1 / Glyma01g36780.1)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Etiolated hypocotyls
Hypocotyls
Seed buds
Seedlings
Whole seedlings
Young leaves
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx88
start..stop
S start..stop
GmPrx06 629 0 1..317 1..316
MtPrx08 571 0 1..317 1..316
LjPrx29 547 0 1..317 1..316
MtPrx92 530 0 19..317 21..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49214232..49214438 207 N° 2 49214549..49214737 189 N° 3 49214880..49215042 163 N° 4 49215147..49215541 395
join(49214232..49214438,49214549..49214737,49214880..49215042,49215147..49215541 )


exon

Literature and cross-references GmPrx88 (sEpb1 / Glyma01g36780.1)
Literature Chen,H. and Vierling,R.A. Molecular cloning and characterization of soybean peroxidase gene families. Plant Sci. 150 (2), 129-137 (2000).
Protein ref. UniProtKB:   Q9ZRG6
DNA ref. Phytozome 11:   Gm01 (49214232..49215541)
Protein sequence: GmPrx88 (sEpb1 / Glyma01g36780.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (296)
PWM (Da):   %s   34375.54 (32054.3)  
PI (pH):   %s   9.71 (9.71) Peptide Signal:   %s   cut: 22 range:22-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVMVAFLNLIIIFSVVSTTGKSLSLNYYAKTCPNVEFIVAKAVKDATARDKTVPAAILRMHFHDCFVRGCDASVLLNSKGNNKAEKDGPPNVSLHAFYVIDAAKKALEASCPGVVSCADILALAARDAVFLSGGPTWDVPKGRKDGRTSKASETRQLPAPTFNLSQLRQSFSQRGLSGEDLVALSGGHTLGFSHCSSFKNRIHNFNATHDVDPSLNPSFAAKLISICPLKNQAKNAGTSMDPSTTTFDNTYYRLILQQKGLFSSDQVLLDNPDTKNLVTKFATSKKAFYEAFAKSMIRMSSINGGQEVRKDCRMIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 7 EST and 1 cDNA. (U51193).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTCATGGTTGCATTCTTGAATTTGATCATCATCTTTTCAGTAGTCTCTACAACAGGCAAGTCACTGAGCTTAAACTACTATGCAAAAACATGCCCTAATGTGGAGTTCATTGTT
GCCAAGGCAGTAAAGGATGCCACTGCTAGGGACAAAACTGTTCCAGCAGCAATTCTGCGAATGCACTTCCATGATTGTTTCGTTCGG
GTAATGCTATTTTGACCCCTCCTCCCTCCTTTC
CTCTTGACTGCTTCCGCCTCATTTGATGCATCATGAAATCAAATCATATTGTTTTCTTTTTTCCTATACTCTTGAAGGGGTGTGATGCCTCTGTGCTGCTAAATTCAAAAGGAAACAACA
AAGCAGAAAAAGACGGGCCACCAAATGTTTCTTTGCATGCATTCTATGTCATTGATGCAGCAAAGAAAGCACTAGAAGCTTCATGCCCTGGTGTGGTCTCTTGTGCTGACATCCTTGCTC
TGGCAGCAAGGGACGCAGTTTTTCTG
GTAAGAAAACTTTGAAAAGTACCAAATTTCTCATCATTCAGATCCTAAACTAAACAATCATTATGTCTTCGAGAATTGACAAATGCAGCTAAGG
TGGCTTGTATTTGGAAGTCTTGACTAATTGTATAAATATATTCTGCAGTCAGGAGGACCTACATGGGATGTTCCTAAAGGAAGAAAGGATGGTAGAACATCTAAAGCCAGTGAAACCAGA
CAATTGCCAGCACCAACCTTCAACTTATCACAACTGCGGCAAAGTTTCTCTCAAAGAGGACTGTCAGGGGAAGACCTGGTAGCTCTGTCAG
GTAAGCTATTCCTAAAGTCAAAACTGCCA
AAACTTGACCATTTTTCATTTATTCCAATTTATATCTGAATAGAGTTTAGAGTTTCTCCTTTGACTCATATGTAGGGGGGCACACTTTGGGTTTCTCTCACTGCTCATCTTTCAAGAACA
GAATCCACAACTTCAATGCAACACATGATGTTGACCCTTCATTAAATCCATCATTTGCAGCAAAACTGATCTCAATTTGTCCACTAAAAAATCAGGCAAAAAATGCAGGCACCTCTATGG
ACCCTTCAACAACAACTTTTGATAATACATATTACAGGTTGATCCTCCAACAGAAAGGCTTGTTTTCTTCTGATCAAGTTTTGCTTGACAACCCAGACACTAAAAATCTGGTTACAAAGT
TTGCCACCTCAAAAAAGGCTTTTTATGAGGCTTTTGCGAAGTCCATGATCAGAATGAGTAGCATCAATGGTGGACAGGAGGTTAGAAAGGACTGCAGAATGATCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTCATGGTTGCATTCTTGAATTTGATCATCATCTTTTCAGTAGTCTCTACAACAGGCAAGTCACTGAGCTTAAACTACTATGCAAAAACATGCCCTAATGTGGAGTTCATTGTT
GCCAAGGCAGTAAAGGATGCCACTGCTAGGGACAAAACTGTTCCAGCAGCAATTCTGCGAATGCACTTCCATGATTGTTTCGTTCGG
GGGTGTGATGCCTCTGTGCTGCTAAATTCAAAA
GGAAACAACAAAGCAGAAAAAGACGGGCCACCAAATGTTTCTTTGCATGCATTCTATGTCATTGATGCAGCAAAGAAAGCACTAGAAGCTTCATGCCCTGGTGTGGTCTCTTGTGCTGAC
ATCCTTGCTCTGGCAGCAAGGGACGCAGTTTTTCTG
TCAGGAGGACCTACATGGGATGTTCCTAAAGGAAGAAAGGATGGTAGAACATCTAAAGCCAGTGAAACCAGACAATTGCCAGCA
CCAACCTTCAACTTATCACAACTGCGGCAAAGTTTCTCTCAAAGAGGACTGTCAGGGGAAGACCTGGTAGCTCTGTCAG
GGGGGCACACTTTGGGTTTCTCTCACTGCTCATCTTTCAAG
AACAGAATCCACAACTTCAATGCAACACATGATGTTGACCCTTCATTAAATCCATCATTTGCAGCAAAACTGATCTCAATTTGTCCACTAAAAAATCAGGCAAAAAATGCAGGCACCTCT
ATGGACCCTTCAACAACAACTTTTGATAATACATATTACAGGTTGATCCTCCAACAGAAAGGCTTGTTTTCTTCTGATCAAGTTTTGCTTGACAACCCAGACACTAAAAATCTGGTTACA
AAGTTTGCCACCTCAAAAAAGGCTTTTTATGAGGCTTTTGCGAAGTCCATGATCAGAATGAGTAGCATCAATGGTGGACAGGAGGTTAGAAAGGACTGCAGAATGATCAATTAA

Retrieve as FASTA