Entry information : CsaPrx05 (Cucsa.229260. / LPO)
Entry ID 2920
Creation 2006-10-26 (Christophe Dunand)
Last sequence changes 2011-06-30 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsaPrx05 (Cucsa.229260. / LPO)
Name (synonym) CsaPrx05 (Cucsa.229260. / LPO)
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type N/D
Inducer Lignification
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx05
start..stop
S start..stop
CsaPrx71 562 0 6..316 11..320
MePrx138 477 2e-171 8..316 17..325
MePrx28 476 3e-171 8..316 17..325
RcPrx36 476 6e-171 11..316 20..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59875..60273 399 N° 2 60374..60539 166 N° 3 60636..61021 386  
join(59875..60273,60374..60539,60636..61021)


exon

Literature and cross-references CsaPrx05 (Cucsa.229260. / LPO)
Literature Deepak,S.A. and Ishii,H. Acibenzolar-S-methyl primes cell wall strengthening genes and reactive oxygen forming enzymes in cucumber against fungal pathogen attack, Unpublished
Protein ref. UniProtKB:   Q45L80
DNA ref. Phytozome 12:   scaffold01939 (59875..61021)
mRNA ref. GenBank:   DQ124871
Protein sequence: CsaPrx05 (Cucsa.229260. / LPO)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (294)
PWM (Da):   %s   34221.17 (31755.9)  
PI (pH):   %s   7.68 (7.99) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSMPPLLVLAFTFLLFGLACDAQLSSSFYDQTCPTALTTIRTVIRQAISQERRMAASLIRLHFHDCFVQGCDASILLDDTPSMIGEQNAAPNRDSARGYGVIHNAKTAVEKICPGVVSCADILAVAARDASFAVGGPSWTVRLGRRDSTTASKALAENELPHFQAGLDRLISIFSNKGLSTRDMVALSGSHTIGQAQCFLFRNRIYNQTNIDAGFASTRRRNCPTSSGNGNLAPLDLVTPNSFDNNYFKNLVQRKGLLETDQVLFNGGSTDSIVTEYSKDPTMFKSDFAAAMIKMGNIQPLTGLEGEIRNICGIVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST. Probably a ligin synthesis peroxidase (Lignin peroxidase-like (LPO)°. Cultivar="Shin Suyo Tsukemidori".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAATGCCTCCCCTACTTGTTCTTGCATTCACCTTCTTGCTTTTCGGTTTAGCATGTGATGCTCAACTTTCCTCTTCCTTTTACGACCAAACTTGTCCTACTGCACTTACAACTATT
AGAACTGTCATTCGACAAGCCATCTCCCAAGAGCGCCGTATGGCTGCATCTCTCATTCGCCTCCATTTCCACGATTGTTTTGTTCAGGGTTGCGATGCGTCGATATTGCTTGATGATACT
CCCTCTATGATTGGTGAACAAAATGCAGCACCCAATAGAGACTCTGCTAGAGGTTATGGGGTGATACACAACGCCAAGACGGCAGTTGAGAAGATTTGTCCCGGCGTTGTATCTTGTGCT
GATATTCTTGCAGTTGCTGCAAGAGATGCTTCTTTTGCT
GTGAGTACTTGATCTTCGGCATCCATCTATGCACTATATATGTCAAAATATTATGAATATTGTCTTTTCTCATACTAAATA
TTATTTGTACAAAAATTAGGTCGGTGGTCCATCATGGACAGTAAGGCTTGGAAGAAGAGATTCGACCACTGCAAGCAAAGCTTTAGCAGAGAATGAGCTTCCACATTTTCAAGCAGGTCT
TGATCGGCTTATTTCCATCTTTTCAAATAAAGGACTTAGTACAAGAGATATGGTTGCACTCTCCG
GTAATTAAATCTTTTAAGTTTTTTGAATTCATCATATAAATTATTATATGCATCA
ACTTTTATTAATTCATGTACACGTTAATTCTATTATTGCAGGTTCTCATACTATAGGGCAAGCCCAATGTTTTCTCTTCCGTAATAGAATATACAATCAAACTAATATCGATGCAGGATT
TGCTAGCACACGTCGAAGGAATTGTCCAACATCGAGTGGGAATGGAAATTTGGCACCACTGGATTTGGTCACACCCAATTCCTTTGACAACAATTACTTCAAAAATCTTGTTCAAAGAAA
AGGTTTGCTAGAAACAGATCAAGTTCTCTTTAACGGAGGATCAACAGATAGCATTGTTACAGAGTATAGCAAAGATCCAACTATGTTCAAATCTGACTTTGCAGCAGCAATGATCAAAAT
GGGAAATATTCAACCTCTCACTGGTTTAGAGGGAGAAATAAGAAATATTTGTGGTATCGTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAATGCCTCCCCTACTTGTTCTTGCATTCACCTTCTTGCTTTTCGGTTTAGCATGTGATGCTCAACTTTCCTCTTCCTTTTACGACCAAACTTGTCCTACTGCACTTACAACTATT
AGAACTGTCATTCGACAAGCCATCTCCCAAGAGCGCCGTATGGCTGCATCTCTCATTCGCCTCCATTTCCACGATTGTTTTGTTCAGGGTTGCGATGCGTCGATATTGCTTGATGATACT
CCCTCTATGATTGGTGAACAAAATGCAGCACCCAATAGAGACTCTGCTAGAGGTTATGGGGTGATACACAACGCCAAGACGGCAGTTGAGAAGATTTGTCCCGGCGTTGTATCTTGTGCT
GATATTCTTGCAGTTGCTGCAAGAGATGCTTCTTTTGCT
GTCGGTGGTCCATCATGGACAGTAAGGCTTGGAAGAAGAGATTCGACCACTGCAAGCAAAGCTTTAGCAGAGAATGAGCTT
CCACATTTTCAAGCAGGTCTTGATCGGCTTATTTCCATCTTTTCAAATAAAGGACTTAGTACAAGAGATATGGTTGCACTCTCCG
GTTCTCATACTATAGGGCAAGCCCAATGTTTTCTC
TTCCGTAATAGAATATACAATCAAACTAATATCGATGCAGGATTTGCTAGCACACGTCGAAGGAATTGTCCAACATCGAGTGGGAATGGAAATTTGGCACCACTGGATTTGGTCACACCC
AATTCCTTTGACAACAATTACTTCAAAAATCTTGTTCAAAGAAAAGGTTTGCTAGAAACAGATCAAGTTCTCTTTAACGGAGGATCAACAGATAGCATTGTTACAGAGTATAGCAAAGAT
CCAACTATGTTCAAATCTGACTTTGCAGCAGCAATGATCAAAATGGGAAATATTCAACCTCTCACTGGTTTAGAGGGAGAAATAAGAAATATTTGTGGTATCGTTAACTAA

Retrieve as FASTA