Entry information : SbGPx01 (Sobic.006G173900.1 [2.1] / Sb06g024920 [1.4])
Entry ID 2924
Creation 2006-03-24 (Marcia Pinheiro Margis)
Last sequence changes 2006-03-24 (Marcia Pinheiro Margis)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-06 (Messaoudi)
Peroxidase information: SbGPx01 (Sobic.006G173900.1 [2.1] / Sb06g024920 [1.4])
Name (synonym) SbGPx01 (Sobic.006G173900.1 [2.1] / Sb06g024920 [1.4])
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Callus
Cell culture
Flowers
Leaves
Pollens
Roots
Seeds
Inducer Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbGPx01
start..stop
S start..stop
SpGPx01 346 1e-124 1..168 1..168
SiGPx01 342 6e-123 1..168 1..168
ZmGPx01 339 5e-122 1..168 1..168
ZmGPx01-2 333 1e-119 1..168 1..168
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 53956974..53957021 48 N° 2 53957412..53957488 77 N° 3 53957757..53957818 62 N° 4 53957998..53958116 119
N° 5 53958317..53958484 168 N° 6 53958580..53958612 33  
join(53956974..53957021,53957412..53957488,53957757..53957818,53957998..53958116 ,53958317..53958484,53958580..53958612)


exon

Literature and cross-references SbGPx01 (Sobic.006G173900.1 [2.1] / Sb06g024920 [1.4])
Literature 1) Lai J., Ma J., Swigonova Z., Ramakrishna W., Linton E., Llaca V., Tanyolac B., Park Y.J., Jeong O.Y., Bennetzen J.L., Messing J.;
"Gene loss and movement in the maize genome.";
Genome Res. 14:1924-1931(2004).

2)Swigonova Z., Bennetzen J.L., Messing J.;
"Structure and evolution of the r/b chromosomal regions in rice, maize, and sorghum.";
Genetics 169:891-906(2005).

3)Swigonova Z., Lai J., Ma J., Ramakrishna W., Llaca V., Bennetzen J.L., Messing J.;
"Close split of sorghum and maize genome progenitors.";
Genome Res. 14:1916-1923(2004).
Protein ref. GenPept:   AAT42166 UniProtKB:   Q6JAG4
DNA ref. Phytozome 11:   chromosome_6 (53956974..53958612)
Cluster/Prediction ref. UniGene:   Sbi.17893   Sbi.7722
Protein sequence: SbGPx01 (Sobic.006G173900.1 [2.1] / Sb06g024920 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18346.29  
PI (pH):   %s   7.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAASSATSVHDFTVKDASGKDVDLSTYKGKVLLIVNVASQCGLTNSNYTELAQLYEKYKDGFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDVDVNGNNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 19 + 3 ESTs (two unigenes).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCGCGTCGTCCGCCACCTCCGTCCACGACTTCACCGTCAAGGTCAGTCCCGTTTCCCCTCGTCGCCTTCTCATCGACCCAAAAACGTTCCGGTGCTTAGATTCCGGAGGTGAT
AGTAGGATCATAGGACCCCCCCCCCCCCCCCCCCCCCCCGCGTAATAGTTCGCATGGGGAGCGCTTGCTTAGCGTGCCTCGGAGCCGCAAGCCCGAGCCCGCTGTGCTGTGCTTAGTCCG
GGCACCAGTGGTTCCTGATTCGTGCGGAGCTTACTGTGAATTTCGCTGTCGATCCGTTTGATTCACTTGCAAAAATGACTGAATTTCTTAGCCATGAGCTAGCTGTGTTTGCCGGATTTT
TAGAAGAGTAGATGCCGCAGCCTCTGATTTTGCAGCGGGGAGTCTAACGATTGCTTTTTGCTTGCTGCTCTTGTGCAGGATGCCAGCGGCAAAGACGTTGACCTCAGCACCTACAAGGGG
AAGGTTCTTCTCATCGTTAACGTCGCATCCCAGTG
GTATGAAAGTCATCTGGAGCAGAACCTCGCGTCTACCTAACCTTCTTACTACTGTCCTTGTTTGGTCCATTGCAAAATTCTATCA
TTAAGCTGGTTCATGTCTTCTACTACCTGGAATCATTTGTTCCTACTCGATATAAAATAATGGTTTTTATCTGTGCTTACTTATTTCACTGTCAGACGTAGGAGTAGACATCTTTTGTTT
ACACTGTATAGAAAACATTATTCTGTACACTGCTAATTGCTGCACTGTGACCGATTGTTTCAGTGGCTTAACCAACTCCAACTACACCGAGCTGGCCCAGCTCTATGAGAAGTACAAGGA
CCAAG
GTGTTTCCTTAATCCATTGCTCTTGTATATTCTTAGTCTTGTAGTGCCTATCTCTGTTGGCATGGCCTTATGTTTTAGTGGTTTATTTTATCCAAATATCGGTTGTTCATTGATT
TAGACAATTCCGGTTGTGGGGATGCTAATTGCTAGGTACAATTGCCAATTTGTGATCTATGCAGGCTTTGAAATTCTGGCTTTCCCATGCAACCAGTTTGGTGGGCAGGAGCCTGGTACC
AACGAGGAGATTGTGCAGTTTGCCTGCACACGCTTCAAGGCTGAGTACCCCATCTTCGACAAG
GTAAAGTTATAGGCTTCTAGCTGTTTCTCCTCAACCAGAGAAATGCACAGTAGTAGG
ATAGCTGTCTTAATGCAAAGATACAGTTATCTAACTTAGCAGGATGATGTGAGGATATCAGTGATGTGTGATGATCCTAAGAGACCCATGTAGAATGGTCTGTTATGGAGTAGTACTGAC
TTCTATCTCTTATTGCTTGTCAGGTTGATGTCAATGGTAACAATGCTGCGCCCATCTACAAGTTTCTGAAATCTAGCAAGGGTGGCCTTTTTGGCGACAGCATCAAGTGGAACTTTTCCA
AGTTCTTGGTTGACAAGGAGGGACGTGTTGTGGATCGCTATGCTCCAACAACTTCACCTCTGAGCATTGAG
GTAAACTTTCAGCACCGCAATTCACATTTGTTGTAAGCGCTTAACTAGT
ATGCTGTTGTGATATCATTATTAATGTTTTTCTATAATCTCTGCAGAAGGATATCAAGAAGCTGCTTGGGAGCTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCGCGTCGTCCGCCACCTCCGTCCACGACTTCACCGTCAAGGATGCCAGCGGCAAAGACGTTGACCTCAGCACCTACAAGGGGAAGGTTCTTCTCATCGTTAACGTCGCATCC
CAGTG
TGGCTTAACCAACTCCAACTACACCGAGCTGGCCCAGCTCTATGAGAAGTACAAGGACCAAGGCTTTGAAATTCTGGCTTTCCCATGCAACCAGTTTGGTGGGCAGGAGCCTGGT
ACCAACGAGGAGATTGTGCAGTTTGCCTGCACACGCTTCAAGGCTGAGTACCCCATCTTCGACAAG
GTTGATGTCAATGGTAACAATGCTGCGCCCATCTACAAGTTTCTGAAATCTAGC
AAGGGTGGCCTTTTTGGCGACAGCATCAAGTGGAACTTTTCCAAGTTCTTGGTTGACAAGGAGGGACGTGTTGTGGATCGCTATGCTCCAACAACTTCACCTCTGAGCATTGAG
AAGGAT
ATCAAGAAGCTGCTTGGGAGCTCTTAA

Retrieve as FASTA