Entry information : RoGPx01
Entry ID 2959
Creation 2007-01-17 (Felipe Teixeira)
Last sequence changes 2012-05-07 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Filippo Passardi
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: RoGPx01
Name RoGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Mucoraceae Rhizopus
Organism Rhizopus oryzae    [TaxId: 64495 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RoGPx01
start..stop
S start..stop
PblGPx02 214 9e-73 1..159 1..159
UramGPx01 209 1e-70 4..159 12..167
McirGPx01 205 4e-69 1..159 1..159
SceGPx03 198 2e-66 1..159 1..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 513516..513590 75 N° 2 513332..513467 136 N° 3 513262..513279 18 N° 4 513137..513194 58
N° 5 513014..513082 69 N° 6 512934..512961 28 N° 7 512783..512878 96  
complement(join(512783..512878,512934..512961,513014..513082,513137..513194,5132 62..513279,513332..513467,513516..513590))


exon

Literature and cross-references RoGPx01
Literature Lang,B.F., Ma,L.J. and Skory,C.D. ESTs of Rhizopus oryzae. Unpublished (2006)
DNA ref. JGI genome:   supercontig_3.14 (513590..512783)
mRNA ref. GenBank:   EE006380
Protein sequence: RoGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   159
PWM (Da):   %s   18012.3  
PI (pH):   %s   8.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRLYELTVKTITGQDWQLGALKGKVVLFVNVASKCGFAKQYHELENLYSKYKDQGFEVIGVPCNQFNNQEPGSGEEILKLVKEKYNVNFPLLEKQDVNGSNESPLYKFLKESKSGILGLHVVKWNFKFLVDRSGHVVHRYSSMTDPHSIAPEIEKLL*

Retrieve as FASTA  
Remarks Complete sequence from mRNA. Strain ="RA 99-880"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAAGATTATACGAGTTAACAGTCAAGACGATCACAGGCCAAGATTGGCAACTGGGTGCTTTGAAAGGAAAGGTAAAGGAGGATAGGATGGAATGAAACAAAAGCTGATGGACATCA
AAGGTGGTTCTTTTTGTGAACGTGGCTTCTAAATGTGGATTTGCTAAACAATACCATGAATTGGAAAACCTGTATAGTAAATATAAAGACCAAGGGTTTGAAGTGATTGGCGTACCTTGT
AATCAATTCAACAATCAAG
GTAAAATCATGTACTATAACTCAATAAGCTCATGTCTGATACAAAAATATAGAACCTGGAAGTGGAGAAGGTAACATCTTGGGACATAACAGAAAGAGAAA
AGAAATAAAAGACTAAACATCCACTTGGAATCATAGAAATCTTGAAGCTTGTGAAGGAAAAATACAATGTGAACTTTCCTTTACTTGAGAAACAGTAAGCATTTTAAATCATCTATTCCA
AAAAGGAAACTAATGACGTGACAATAAGGGATGTCAATGGATCGAATGAATCCCCACTTTACAAGTTTTTAAAAGAATCAAAATCGGGCATACTTGGGTAAATAACGAAACTATGCTGAA
CTACTTTACACATTCATCCTTTCTTTTAGACTTCATGTCGTCAAATGGAATTTTGAGGTACTTGTTTCCTCCCCTAAAAAAAACCATCTTCAAAAAGCTAACTCGATTTTAGAAATTTTT
GGTGGATCGTTCAGGTCATGTTGTTCACCGCTATTCTTCAATGACAGATCCTCATTCGATTGCACCTGAAATTGAAAAATTATTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAAGATTATACGAGTTAACAGTCAAGACGATCACAGGCCAAGATTGGCAACTGGGTGCTTTGAAAGGAAAGGTGGTTCTTTTTGTGAACGTGGCTTCTAAATGTGGATTTGCTAAA
CAATACCATGAATTGGAAAACCTGTATAGTAAATATAAAGACCAAGGGTTTGAAGTGATTGGCGTACCTTGTAATCAATTCAACAATCAAG
AACCTGGAAGTGGAGAAGAAATCTTGAAG
CTTGTGAAGGAAAAATACAATGTGAACTTTCCTTTACTTGAGAAACA
GGATGTCAATGGATCGAATGAATCCCCACTTTACAAGTTTTTAAAAGAATCAAAATCGGGCATACTTGGACTT
CATGTCGTCAAATGGAATTTTGAG
AAATTTTTGGTGGATCGTTCAGGTCATGTTGTTCACCGCTATTCTTCAATGACAGATCCTCATTCGATTGCACCTGAAATTGAAAAATTATTATAA

Retrieve as FASTA