Entry information : ZmGPx01
Entry ID 2965
Creation 2006-04-18 (Marcia Pinheiro Margis)
Last sequence changes 2006-04-18 (Marcia Pinheiro Margis)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmGPx01
Name ZmGPx01
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Embryosac
Flowers
Mixed tissues
Seedlings
Seeds
Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmGPx01
start..stop
S start..stop
SpGPx01 339 5e-122 1..168 1..168
SbGPx01 339 5e-122 1..168 1..168
SiGPx01 336 1e-120 1..168 1..168
ZmGPx01-2 327 3e-117 1..168 1..168
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18618613..18618660 48 N° 2 18618098..18618174 77 N° 3 18616825..18616886 62 N° 4 18616525..18616643 119
N° 5 18616029..18616196 168 N° 6 18615901..18615933 33  
complement(join(18615901..18615933,18616029..18616196,18616525..18616643,1861682 5..18616886,18618098..18618174,18618613..18618660))


exon

Literature and cross-references ZmGPx01
Literature REFERENCE 1 Lai J., Ma J., Swigonova Z., Ramakrishna W., Linton E., Llaca V., Tanyolac B., Park Y.J., Jeong O.Y., Bennetzen J.L., Messing J. Gene loss and movement in the maize genome. Genome Res. 14:1924-1931(2004).
REFERENCE 2 Swigonova Z., Bennetzen J.L., Messing J. Structure and evolution of the r/b chromosomal regions in rice, maize, and sorghum. Genetics 169:891-906(2005).
REFERENCE 3 Swigonova Z., Lai J., Ma J., Ramakrishna W., Llaca V., Bennetzen J.L., Messing J. Close split of sorghum and maize genome progenitors. Genome Res. 14:1916-1923(2004).
Protein ref. UniProtKB:   Q6JAH6   B6TR92 [Mismatch]
DNA ref. GenBank:   48374953   AY542310 (26223..28982)
Protein sequence: ZmGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18361.33  
PI (pH):   %s   7.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSTATSVHDFIVKDASGKDVDLSTYKGKVLLIVNVASQCGLTNSNYTELAQLYEKYKDGFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDVDVNGSNAAPIYKFLKSSKGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromosome 2, 5 introns), 6 cDNA and 157 mRNA.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTCGTCGACCGCCACCTCCGTCCACGACTTCATCGTCAAGGTCAGTCCCATTCCCCTCGTCGCCCTCTCAACCCCTAAACGCCTCCGTGCGTAGATTCCAGAGGTGGTACGA
TCATAGGCCCTCTGAACCCCAAAACGTCTCTGTGCGTAGATTCCAGAGGTGATAGGATCATAGGACCCCCGTAAATCCGTAATATTTTGCATGGATCGCTTGCTTTGCGTGCGGCGTGCC
CCGGAGCTGCAAGCTCGAGGCCACTGTGCTGTGCTTAGTCCGGGATTGGGGCTTTATGGTTCCTGATTCGTGCGGAGCTCTTAGTGTGAATTTCGCTGTCGAACCGTGTGATTTGGCTTG
CAAAATGACTGGATTTGCTAACCCTTACCTAGCGGTTTTTGCCGAATTTTTAGAAGAGTAGATGCCGCGGCTTATGTTTTTGCAGAGGAGTCTAATTATCGCCTTCTGCTTGCTGCTCGT
CTGCAGGATGCGAGCGGCAAAGACGTTGACCTCAGCACCTACAAGGGGAAGGTTCTTCTCATTGTTAACGTCGCATCCCAGTGGTATGAATCATCTGCAGCAGAAACTTTTCTAATCTTC
TTACTATTTGTGATTGTTTGGCCCATGGCAAAAGCGTATCAGTAAGGTCGTTGGTGTCTTCTACTACGAGGACATATCCTGTGCAATCACTTATCCTGGTGCAAGCGTGCAATCAAGCGA
TCTGGTGCATCCGATCTAGATCTAACGGTTTCCAGGGCCGTCCCTGTGGGGGTGCCAAGGGTGCAGCCGCACCGGGCCCCCAAAAATAGAGGGCCCCGTAGCCACTGTACGGTAGTATTT
TTTCCTATTAAACTTATCTATTATAGACACAAATACGTAAAGTGTGATGCGTTATCGAGCTATCAACTAGTCTCGTTTATATTCTTAAACTGTCTCAATTACTTATCCAATACCCATCCG
TTTCAAAATAGTATTTGTTTTAGTTCTTAATTTTTATGTTTATATTGATGATGATAAATCCACTAAAGAAGCAAAACAAATTCTATTTTGATATAGGGAGAGTATTATAAACTATACATA
TGATGGTTGCTTTGGCAGAGAGAAGCTTTTTAAAATTGAAATATTTTTGTGAACTATTTTTGATCAACAATAACTCAAGAGATGTTAAATGGCTTGGTGATTCTATATATCGAAAAAAGT
TGTTGGATGAGATTGATCTCAATGATAGAAGAGATGACTTTGTATCACAAAATGTTAAAAGATATTTTTAATAATATGAGATAACAAGTGTTTTTGCTATATTTTACATTTGTTATCTTG
TAAACTTTAAAATAGTGCATAATAATTTTTATATATTAAATATTTGATAATATATATAATTATATATATATGTGGATGGGCCTCGATATCGGATTTCGCACCGGGCCCCTGAAAAGTCAG
GAACGGCCCTGACGGTTTCATATGGAAGGGGTTAAAAGTAAAATATGTACTATGTTTTAGGTGGAAGGGGTTACATATAAAATAACAGTCATCATTAGATCTAGATCGGATGCACCAGAT
CGCTTGATTGCACGCTTGCACCAGGATAAGTGATTGCACAGGATATGTCCTCTTCTACTACCTGGAATCAGTTGTTCCTATACTTGATATAAAATATTGGTTTTATCTGTGCTTACTTAT
TTCACTGTCAGACGTAGACATCTTTTGTTTACAGTGTATAGGAAAACATTATTCTGTACACTGCTAATTGCTGCACTGTGACCGATTATTTCAGTGGCTTAACCAACTCCAACTACACTG
AGCTGGCCCAGCTCTATGAGAAGTACAAGGACCAAG
GTGTGTCCTTAATCCATTGCTTTTTGTATATTCTTAATCTTGTAATGCTTATCTGTGTTCTCATGGGCATATGCATTATTGGTT
TATTTTATCCAACTATTGGTTGTTCGTCAATCTAAACAATTCCGGTTGTTGGGGATGCTAATTGCTAAGCACAATTGCTAAATTGTGATCTTTGCAGGCTTTGAAATCCTGGCTTTCCCA
TGCAACCAGTTTGGTGGGCAGGAGCCTGGTACCAATGAGGAGATTGTCCAGTTTGCCTGCACACGCTTCAAGGCTGAGTACCCCATCTTCGACAAG
GTAAAAACTCTAGTCTTCTAGCTG
TTTCTCCTCTAATACACTGTATTCTCTCAGTTCCAAATTATAAGACGTTTTGAATTTTTATAAGCTTTAACTATGTATCTAGACATAATGTATATCGAAGTGCATAGAAAAAACTATGTA
TGTAGAAAAAATATTACATATTATAATTTAGAATGGAGGGTGTAGTAGGATAAAGCTGCCTCAATGCAAAGATACAGTTATCTAGCTTGTCAGGGTGATGTGAGGATATTAGTGATGATC
CTAACAGACCCATGTAGAATGGTCTGTTGTGGAATAGTACTAACCTCTATCTATTGCTTGTCAGGTTGATGTCAACGGTAGCAATGCTGCGCCCATCTACAAGTTCTTGAAATCTAGCAA
AGGTGGCCTTTTCGGCGACAGCATCAAGTGGAACTTTTCCAAGTTCTTGGTTGACAAGGAGGGACGTGTTGTGGATCGCTATGCTCCAACCACTTCACCCCTGAGCATTGAG
GTGAACTT
TCAGCGCTGCAGTTCACATTTGCTATGAGAGCTTAACTAGTAAGCTATTATGATATCATTATAACATTTTCTCTATAATCTCTGCAGAAGGATATCAAGAAGCTGCTTGGGAGCTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTCGTCGACCGCCACCTCCGTCCACGACTTCATCGTCAAGGATGCGAGCGGCAAAGACGTTGACCTCAGCACCTACAAGGGGAAGGTTCTTCTCATTGTTAACGTCGCATCC
CAGTG
TGGCTTAACCAACTCCAACTACACTGAGCTGGCCCAGCTCTATGAGAAGTACAAGGACCAAGGCTTTGAAATCCTGGCTTTCCCATGCAACCAGTTTGGTGGGCAGGAGCCTGGT
ACCAATGAGGAGATTGTCCAGTTTGCCTGCACACGCTTCAAGGCTGAGTACCCCATCTTCGACAAG
GTTGATGTCAACGGTAGCAATGCTGCGCCCATCTACAAGTTCTTGAAATCTAGC
AAAGGTGGCCTTTTCGGCGACAGCATCAAGTGGAACTTTTCCAAGTTCTTGGTTGACAAGGAGGGACGTGTTGTGGATCGCTATGCTCCAACCACTTCACCCCTGAGCATTGAG
AAGGAT
ATCAAGAAGCTGCTTGGGAGCTCTTAA

Retrieve as FASTA