Entry information : ZmGPx03
Entry ID 2966
Creation 2009-04-14 (Christophe Dunand)
Last sequence changes 2010-12-23 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-12-28 (Christophe Dunand)
Peroxidase information: ZmGPx03
Name ZmGPx03
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Ears
Embryos
Endosperm
Flowers
Inflorescences
Meristems
Pollens
Roots
Seedlings
Seeds
Sheaths
Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmGPx03
start..stop
S start..stop
SbGPx03 429 8e-155 1..245 1..247
OsGPx03 353 3e-125 1..246 1..238
TaGPx03-1A 339 2e-119 1..246 1..237
SpGPx01 335 4e-119 79..246 1..168
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 153394487..153394768 282 N° 2 153395045..153395121 77 N° 3 153397255..153397316 62 N° 4 153397461..153397579 119
N° 5 153397915..153398082 168 N° 6 153398173..153398205 33  
join(153394487..153394768,153395045..153395121,153397255..153397316,153397461..1 53397579,153397915..153398082,153398173..153398205)


exon

Literature and cross-references ZmGPx03
Literature Holtgraewe D.L., Altmann B., Scholz A., Winter H. Nucleotide sequence of glutathione peroxidase cDNA of maize. Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases.
Protein ref. UniProtKB:   B4FRF0   Q8LK64 [3' end]   B6U7Y2 [Other strain]
DNA ref. GenBank:   AC204600 (111844..115006) [Fragment]
mRNA ref. GenBank:   BT039688 [3' end]
Cluster/Prediction ref. UniGene:   Zm.82430
Protein sequence: ZmGPx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   246
PWM (Da):   %s   26711.75  
PI (pH):   %s   8.92
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPPRPVPLFSRLRFRLPSCAAVSISTPPSSAAPLHYGHRTPLASPFPLSPPCPRILRAAVAVSSLDLRPITGGFALFSMAAASSATSVHDFTVKDASGKDVDLSTYKGKVLLIVNVASQCGLTNSNYTELSQLYEKYKDGFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDVDVNGDNTAPIYKFLKSSKGSLFGDNIKWNFSKFLVDKEGHVVERYAPTTSPLSIEKDIKKLLGSS*

Retrieve as FASTA  
Remarks Sequence from genomic (chromo 4, first exon is missing, 5 introns), 2 cDNAs and 68 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCCCCGCCCCGTCCCACTATTCTCTCGCCTGCGCTTCCGCCTCCCGAGTTGCGCCGCCGTCTCCATCTCCACCCCTCCATCCTCCGCGGCGCCCCTGCACTACGGCCATCGCACT
CCCCTCGCTAGCCCTTTTCCTCTGTCCCCACCTTGCCCGCGCATCCTCCGTGCGGCCGTCGCGGTTTCTTCGCTGGATCTGCGCCCGATCACCGGCGGGTTCGCGCTATTCAGCATGGCT
GCTGCCTCCTCCGCCACCTCCGTCCACGACTTCACCGTCAAG
GTGCGCAAAACAGCCCAATCGCCTGTATAGAATACCAATACCCCCATTTCCTTCTGAAAGCGATAGTTCTAAGTTTGC
ATACATGTCCTCGTGGAGTTTAGCATTTGGACATGGGTCCTTCCTCCTTCCCTGATCCCGCTGCTTTTCAAGTTCTGTCGAGTTTCTTACTCCAGTTTCGTTGAAGATTACTTTGTTTCC
GAAAGTCTTCGGATGTGCATGTGCTATATCATACTTAGTGAATTTCTTTTCCTTAAGGATTTTTTTTGTTGATTGCAGGATGCTAGCGGGAAAGATGTGGACCTTAGCACCTATAAGGGG
AAGGTTCTGCTCATAGTCAATGTTGCATCTCAGTG
GTACAAATTTACTGCTTTCTTAATACCATTTTCCGTTGTGTTGCAAAATCGATCTTGGCTTGAAAATTTGTGTGGAATTCATCAT
GTAAACCTCTTATTCATACCGCAATGATCCACGTTTATGGTGAAATTGTTCATAGGAGAGTGCTTTGGTGCTTATTAGCGCCAGTATGCTCATTTAGTTCTTCTAAGAGCATCTCCAAGA
AGGACTCCTATCGTTAGGGCCTAAAAAACAAAATAGGGCCTGTGGTTTAAGTTAATTAGAGCCTTAACAATTTTTTTAACTCCAATAGTGACTCCTAAAACCACGTCAGTTAGTTACCCT
GCGATTTGGCAGCACCATCTTGACATTTCCCATTTGTCCCCACGGTTCACGCGTATATTTGAAGCAGCATCGATTCCAATTCACAGTTCTACGCGATTTCTTGTAGCTTTGCATCAGCAG
AATATGTGCCAGTCCACTATAATTCTTGTGCTGCTATTATTATCATATGCATAGGTCATTAAATTCATCAACTACACCTCCGTGCAAGCTGCAGTTTTCTTCAAATACCCATAATCGTTT
CAATTACAGCCTACAACAAGAACAAGATTTAAGTAAGGATTAGTTTGGAAACTTCATTTTTCCAAGGGATTTTCATTTTCCCAAGGGAAAATGAACTAATTTTCCTTGGGAAAATAAAAA
TACCTTGGGAAAATGGGGTTCCCAAACTAGCCCTAAATTAGATAAGTTTCGCATGGCACAACAAAGCAGAGGCAATGAAAGTGATCACAGTGCTTTCCACCAAACAAAATAAGAACTGCT
CAAATTATGTCTGTACAGGCAACGCCTGACTAGAAGACCCCGTCTACTGGATATGAAGAGTTTAAGTTACCTGAAACAATTTTATCTCAATGCATTGTGATATACTCATATTTAACAGAG
CAAACAGAGCTTCATCAATCAGCAAGCAGCCGTTTCCATCCCTCAGTTTTAATCGTGAAATTTATTAAATCAAAATCGTGTAACCAGGCAATCAAACACGTATATCAAAATGATCCATAG
AAAATATTAGGTCTGAATTAGGCCAGATTTTCTTCAAGTAAACATGATCAGTATTCCAGAAAAACACGAAAGTGGGCTACGACAACGTCCACAAATTCAGCACGCAATAGTTTAGCGTGA
CACAGGGCACTCGAGGCACTCATCAGATTCTACAGAGACAAAATTGAGCTTCAAGGGCTAGTATCTATACTGCACATCACTGAAGCAAATCAATATACAACACAGCACATCGGACATCCA
TGTGGCTAAGATTCCCGTCGATCCATTTCCATGGACAGCTGTGCCGCCGAGTGGAGAGTGGCCGGTCTGACGCTTCAATCGATGGGGATGGAGGAGGTCCGGCAATGGTGGGTGGGCGCT
TCGTCCGTGGGGATGGAGGCAGGCCCTCCGATGATGAGCGAACACGCGGGGAAGTGTGTCGGCGCCCTATGTGGAACAATAAATTCATTGGTTTTGAGGGGATAGGACCCGTCCATAGAG
GTAATACATTTGGGTCCTCAAGTCTAGACTCCTATATTAATTTGATACAAATTTTAAAATAGCTACTCTTTTGGAAGCCATTTTTTCCTCTTAGGTCCTATATTTGAAGATATGACCCAG
GTTAAGACCTCTCTTGGAGATGCTCTAATGCAGTGTACTTTATAATTCGAACTTTATGTTTGTGGATAAGTGCGATGGAGCTAGCATGCACATTATATGCTTTGTTATGCAATGATATTA
GCAAATTCAAATTCAAATTTTACTGTTAAATATATTGTGTTAAACGCTTATCCTGAGCGCCATAGTAGTTTTGTTTCTTGAGAATCAACATTTGAGTTATCCATGTGTGGGTGGAATTTG
CCCGGTAAATAGACATCATGGTAGTGGCTGCAGTTGGACATCAAATTATTGGGACACCTGCCACCTGGACTATTTATGCAAATTTAAGTGTCATGTTATTCATTCCATTTCTATTTGTAC
GTTAAGGACTACATACATTCTTGGATAGTGTTTTTATCCCTGATTCTGTGGTGCACATGTACCATTGTATAAGACTCTGTTGACTACTTTTGAGTTAACATGGCCACTTCTCTTTTATTT
TGTTGCAGTGGCTTAACCAATTCCAACTACACAGAGCTGAGCCAGTTGTATGAGAAGTACAAGGACCAGGGTAAATATCTAATCTCGTGCATCGTTATTGCTTAATTATGGAGTTTGTCT
TTTGTGCATGCTCTGCTGCTCATATAGATTGGATCCTTCATGTCAAAACATAATTGTTGTGCTAAATGTTGTTGTCAATCTGATGCGTCTTTAGGTTTTGAGATCCTTGCATTCCCATGC
AACCAGTTCGGTGGGCAGGAGCCTGGCACTAATGAGGAGATTGTCCAGTTTGCTTGTACTCGCTTCAAGGCTGAGTATCCAATTTTCGACAAG
GTACATTTGCACACAGTACTTATTTCT
TTTATCTTTGTATTTTCCCATCCAAAATGGTAAAAATGTATGCTTAACTTTCATGACCAACTACAGTACTTTGATCAATGAATCCAAGAATTTTCTTTTTTATATATGTTGTCTGTGTGA
AATGTAATACTTGAACTAAATGTTCTGTTGCTAAGTCTATCTTATAATTGTTTTCAAAAACAAATGGAGGGGGTATTAGGGACCATTTTCATTGTTTAATTTATGCATCAGTTGAATTAT
CCATATGCCTGTGAATGTGATTCTGATTAGCATATACGTAGTTTGAAGTTTTTAACTTTCTTCGTTAGGTTGATGTCAATGGTGACAATACTGCACCCATTTACAAGTTCCTGAAGTCCA
GCAAAGGTAGTCTCTTTGGCGATAACATAAAATGGAACTTCTCCAAATTCTTGGTTGACAAAGAGGGGCATGTTGTGGAGCGGTATGCACCAACAACTTCCCCACTGAGCATCGAG
GTAA
ATTCCATTTTAAATTGACCTGGTCGGTGGTCTGGTCATTTGTTTCTTGTCTCATCTTACAGCATTAACTATGGCAAAATTTTGCAGAAGGACATCAAGAAACTACTAGGGAGTTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCCCCGCCCCGTCCCACTATTCTCTCGCCTGCGCTTCCGCCTCCCGAGTTGCGCCGCCGTCTCCATCTCCACCCCTCCATCCTCCGCGGCGCCCCTGCACTACGGCCATCGCACT
CCCCTCGCTAGCCCTTTTCCTCTGTCCCCACCTTGCCCGCGCATCCTCCGTGCGGCCGTCGCGGTTTCTTCGCTGGATCTGCGCCCGATCACCGGCGGGTTCGCGCTATTCAGCATGGCT
GCTGCCTCCTCCGCCACCTCCGTCCACGACTTCACCGTCAAG
GATGCTAGCGGGAAAGATGTGGACCTTAGCACCTATAAGGGGAAGGTTCTGCTCATAGTCAATGTTGCATCTCAGTGT
GGCTTAACCAATTCCAACTACACAGAGCTGAGCCAGTTGTATGAGAAGTACAAGGACCAGG
GTTTTGAGATCCTTGCATTCCCATGCAACCAGTTCGGTGGGCAGGAGCCTGGCACTAAT
GAGGAGATTGTCCAGTTTGCTTGTACTCGCTTCAAGGCTGAGTATCCAATTTTCGACAAG
GTTGATGTCAATGGTGACAATACTGCACCCATTTACAAGTTCCTGAAGTCCAGCAAAGGT
AGTCTCTTTGGCGATAACATAAAATGGAACTTCTCCAAATTCTTGGTTGACAAAGAGGGGCATGTTGTGGAGCGGTATGCACCAACAACTTCCCCACTGAGCATCGAG
AAGGACATCAAG
AAACTACTAGGGAGTTCTTAA

Retrieve as FASTA