Entry information : BrPrx12-1Ab_other (Bra016127)
Entry ID 3038
Creation 2008-01-04 (Christophe Dunand)
Last sequence changes 2014-04-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-04-08 (Christophe Dunand)
Peroxidase information: BrPrx12-1Ab_other (Bra016127)
Name (synonym) BrPrx12-1Ab_other (Bra016127)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Brassica
Organism Brassica rapa    [TaxId: 3711 ]
Cellular localisation N/D
Tissue type Etiolated seedlings
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BrPrx12-1Ab_other
start..stop
S start..stop
ThPrx12 684 0 1..362 23..385
TsPrx12 683 0 1..362 1..363
BoPrx12_other 679 0 1..332 1..332
BrPrx12-1Aa_other 678 0 1..362 1..362
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19296320..19296598 279 N° 2 19297700..19297894 195 N° 3 19298085..19298699 615  
join(19296320..19296598,19297700..19297894,19298085..19298699)


exon

Literature and cross-references BrPrx12-1Ab_other (Bra016127)
Literature Ryu,S.H., Kang,J.S., Kang,C.-h., Kim,C.Y., Choi,Y.J., Lee,S.-H., Bahk,J.D., Lee,S.Y., Cho,M.J. and Lim,C.O. Expressed Sequence Tags of Chinese Cabbage Etiolated Seedling cDNA, Unpublished (2001).
DNA ref. GenBank:   CW978963 Phytozome 12:   A07 (24108710..24110710)
EST ref. GenBank:   EX132867 [5' end]   EX034292 [3' end]
Cluster/Prediction ref. UniGene:   Bra.1663
Protein sequence: BrPrx12-1Ab_other (Bra016127)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (331)
PWM (Da):   %s   39749.44 (36267.4) Transmb domain:   %s   i9-31o
PI (pH):   %s   8.4 (8.21) Peptide Signal:   %s   cut: 32 range:32-362
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKDLSRRVLTFLILISLLAVAMNLLSTVEAQNKKKPRRDVPLVKGLSWSFYQKACPKVESIIRKELKKVFKRDIGLAAAILRIHFHDCFVQGCEASVLLDGSASGPGEQSSIPNLTLRQAAFVVINNLRALVHKQCGQVVSCSDILALAARDSVVLSGGPDYAVPLGRRDSLAFASQNTTLNNLPPPFANASQLIADFANRNLDINDLVALSGGHTIGIAHCPSFTDRLYPNQDPTMNKSFANNLKRTCPTANSSNTQVNDIRSPDVFDNKYYVDLMNRQGLFTSDQDLFTDKRTRGIVESFAIDQKLFFDHFVVGMIKMGQMSVLTGSQGEIRANCSARNTESFMSVLEEGILEEALSMI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2), 23 ESTs (from Brassica rapa subsp. pekinensis) and 1 GSS.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAACCAATT CTCTTTTGTT ATAATGCCCT TTTAAAATGA GATAACATAA AAATGACTAT CTTCGTTTTA ACGATTTTAA TTAATAAATT TCAAACAATT CCTCTATAGA AAAATAATGG  ATGTTCAAAT CCAACTACTC CCTCTGTTGT CCTTAACACA AATAAAGCAG CAAAGAGAGC GTAGCTTGGA CCCCTAGAAA AATATATTGT ACTTTTAGTA GTGATTGTAA TCATATCTTT  TCTTGATGAT ATGATTTTTT TATATAGATT ATAATCTACT TACTACAGAA AAGAGAATAC AAACTTATTT TGATAGTAGT TTGATAAAAA AAAAACTTAT TTTGATAATT TATTCAACAA  TTACACACAT TTATGGAGAC GAACTTGCTT TTTCAATTAT ATGCAAAAAA ACATGTCAAA TTCTGGGTGT AACGTATATC CAATGAATAA TAGGAAAGAG AGAGCAGAGA GGAACGTGGC  GAACACAACT AAAAGGAGTC CTCAAATACA TACAGATGTC AGGTCCTGTG GAACATACTT GTTTGGTGTA CAATCATATG TGCTCACTTT GCATTAGGAT GTTCAAACGT CAATGTCTTT  CATCCTTTTT GGTTATCTCA AATTGTCCCA CCACCTCTGC AAAGTCACAT ACTCACCATC TTCGACTCTT CGTAAACCAT TTACGATCAT CAAGTGCCTT AACGAATATG CCAAAACAAA  GACATTATTC CACTGTCATG AGCTTTATTC CTAAAGTGGA TCAAATATGT GTTGGCCTTT CATACCGACA AAATCATTTT CTTAAGTGAA CACATTATGG TTGGTTAAAA TTTATACTGG  TTTCGTACGT AATATGTATT TTGAACTTGT AATATATTAG CTAGTTAAAC AAATTAACTT ACCTGTAAAT CCAAAAAATG TTAACTAAAA AGTAATATTA TTACGTAACA TTTTAGTTTA  ATATATTGTG TTTACCACGC ATTGACAAAA TAAGTTATGT GATATACTTG TCGGTGATAG TATTTGTTGC CTTTGGATTC TATCTAAGAC TTTCGTTGCG CCGCGGTATT ATTTTCCGTG  GTCCCGTTCA TAACAATCCA AATTGCATGC CACTAACTCG TATACTTTGA CACTATACGC ACATCTTAAT TTTCAAATTA ATGTACCACT ATATATATGT GTACCCACAT AGGTAGATAA  TTTGAATCTT ACACTAATCT TTTATGTTTA TAAGTACTGT TCATTTTTGT ACTTGTGAAA TGATCTGAAT GATGAAATTA TCTCCCTAAA ACATAGCACA TGGGTTTTAA ATTGAGGTTC  AATAGCGCTG GGACAAGACC CTTTAAACGG TTAGGTTGCA GACCAATTAT TATTTATAAC ATCAAAAACA AAAAATTCAC GCGACTATAA GTAGTAAAAT TAAATAGTTT TTTTTTTATT  TTTTAAAAAT TAAATAGTTA TGTATGTCCA TTATTGACAA GGGTTTGACA TTCATTCAAA AAAATTTGAC ATGAGTTTTT TTCTGTGTGT TAATTACATT GCCAATAATT ATTAGAAAAC  TTCTCATAGG TGAACCAACT CAACAAAGTC ACGAAATTGA CGCTAGGGAA GAGAAAATAA ACACGGTTTT GCACATATTT ATCTGCTTTA ATCTTGATCT GAAAAATGTA AGATGTATAC  CTTTTGTTAT ATGAAAAGAA TGTTTGTTAA CCAATTGATA CGTTAATTAT ACGAAGAACG AAACGCAAAC TTTTCAACTT AGATTTTAAA TAAAAAGCTT TCACTTTTGA AAATATTATC  TAAAGACTAG CTTTCCTTTG AACAAACAAA AAAAAGCAAA TAAAATACTT TATCATTCCA TTTTTTCTAA TTAAATAGAT ATTTAAAATA CAATACAAGG ACCACATTTG GCTATAAAAC 
GAAGTCCTCT TGTTTCCGAA GAACATCATT AGGCAGAGAA GATAAAAACT TTTAAAACAA AACACCAACA AGAGAGAAAA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAAGGATTTATCCAGACGTGTCCTCACTTTTCTGATATTGATCTCGTTACTGGCGGTGGCAATGAACCTTCTGTCCACGGTAGAGGCACAGAACAAGAAGAAGCCGAGGAGAGAT
GTTCCTCTAGTGAAAGGTCTCTCATGGAGCTTTTACCAGAAAGCATGTCCAAAAGTGGAAAGCATCATCAGGAAAGAGCTCAAGAAAGTCTTCAAGAGAGACATTGGTTTAGCCGCAGCC
ATCCTTCGCATACATTTCCATGACTGCTTCGTTCAGGTC
TCTATCTTTTTCTTTCTTTTCTCCCTTTTGTGTTGGTCTATTAAGAAACATGAATTTGATGTTCGCTAAGCCTTATCTAAA
ACGGCCTTACGCAAGTAATTTAACGTACTTTTGGTTTGATTAAAAGACTTGTTTTTTTTTTAAGATAAGAAACCATATCCACTTATACCCACATAAAAATGAAATTTGTAAAATCAAGAA
ACATGTTTAACTGTTATACTTATGTTATCACGTGCTAGACTAAATCCGACCAAAACCACCTTAAGAGAAAAACATAAAGTCGCCTCGAAATTCTAAAGAACAAGAAGTAAGGATTGTCTG
TTCTTTATATTTTTTTTTCTTGTAAAGAACAATTTCATACTAATGCGCAAGTGTAAACACTATAGTAATTTGTTTCTGACATTACATGCATTGGGATATAGACTTGAATACAGCAGGACG
TGTGGACCGTGTGGTATTAATACTATACACCCGCTTTTCGTGGGTTAGTTGAGTCGCTTTTAATGAGAGAAAAGTAAATACCCTACCAATGGTACAAAATTACAAATAAGAGAATGCTAT
TGATATATTCAGTTCATTGTGTAACAAAAAAACAGTATTCGATTTTCCTCTACACAAATACTAATCAAATTTTTGTAGCGTTAATTGCAACACCTTGTAATGAGATGTGTGGCCTCCTTT
GATCAGACATATAATATAGCATAGGAAAATCTTGAATAATGTTTTTTTGTTCATTTACTGCTTTCACCATTGAGATGTAATATAAATTGAAACAGGGATGTGAAGCATCAGTGCTGCTAG
ATGGATCAGCGAGTGGACCAGGAGAGCAATCATCGATCCCGAATCTGACACTCCGTCAAGCCGCCTTTGTCGTCATCAATAACCTTCGTGCCCTCGTCCACAAGCAGTGTGGTCAAGTCG
TCTCTTGCTCTGACATCCTCGCTCTAGCCGCCCGTGACTCCGTCGTACTTGTAACCAAACTCTCCCTCTCTCTTCATCAAATCTCTTTGTCTATTTATATCTTTATACTATATTCCAACC
ACACGTGACATACCAATACTATATACTAATAATTGCTGATTACTCTTTGGCCAATTAATGAAGTCAGGAGGGCCAGACTATGCTGTACCACTTGGCCGACGCGACTCACTAGCATTCGCG
AGCCAGAACACAACGTTAAACAACTTGCCGCCACCATTCGCCAACGCGAGCCAGCTCATCGCCGACTTCGCCAATAGAAACCTCGACATCAACGACTTGGTTGCACTCTCCGGTGGACAC
ACCATCGGGATCGCG
CATTGTCCGTCTTTCACAGACCGTCTCTACCCGAACCAAGACCCAACCATGAACAAGTCCTTCGCCAACAACCTTAAACGCACTTGCCCCACCGCTAACTCGAGC
AACACGCAAGTGAATGACATAAGGAGCCCTGACGTGTTTGACAACAAGTACTACGTTGATCTCATGAACCGACAAGGGCTGTTTACATCAGACCAGGACCTGTTCACGGACAAGAGGACA
CGTGGTATCGTGGAGAGCTTTGCCATCGACCAAAAGCTGTTTTTTGATCATTTTGTGGTGGGGATGATCAAGATGGGTCAGATGAGTGTCTTGACGGGGTCACAAGGAGAGATTCGTGCA
AACTGTTCCGCTAGAAACACTGAAAGTTTCATGTCTGTTTTGGAAGAAGGCATACTCGAGGAGGCTCTTTCCATGATCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTAAGGATTTATCCAGACGTGTCCTCACTTTTCTGATATTGATCTCGTTACTGGCGGTGGCAATGAACCTTCTGTCCACGGTAGAGGCACAGAACAAGAAGAAGCCGAGGAGAGAT
GTTCCTCTAGTGAAAGGTCTCTCATGGAGCTTTTACCAGAAAGCATGTCCAAAAGTGGAAAGCATCATCAGGAAAGAGCTCAAGAAAGTCTTCAAGAGAGACATTGGTTTAGCCGCAGCC
ATCCTTCGCATACATTTCCATGACTGCTTCGTTCAGGTC
AAGTCAGGAGGGCCAGACTATGCTGTACCACTTGGCCGACGCGACTCACTAGCATTCGCGAGCCAGAACACAACGTTAAAC
AACTTGCCGCCACCATTCGCCAACGCGAGCCAGCTCATCGCCGACTTCGCCAATAGAAACCTCGACATCAACGACTTGGTTGCACTCTCCGGTGGACACACCATCGGGATCGCG
CATCAG
ACCAGGACCTGTTCACGGACAAGAGGACACGTGGTATCGTGGAGAGCTTTGCCATCGACCAAAAGCTGTTTTTTGATCATTTTGTGGTGGGGATGATCAAGATGGGTCAGATGAGTGTCT
TGACGGGGTCACAAGGAGAGATTCGTGCAAACTGTTCCGCTAGAAACACTGAAAGTTTCATGTCTGTTTTGGAAGAAGGCATACTCGAGGAGGCTCTTTCCATGATCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGAGAAGAT AAAAACTTTT AAAACAAAAC ACCAACAAGA GAGAAAAATG GGTAAGGATT TATCCAGACG TGTCCTCACT TTTCTGATAT TGATCTCGTT ACTGGCGGTG GCAATGAACC  TTCTGTCCAC GGTAGAGGCA CAGAACAAGA AGAAGCCGAG GAGAGATGTT CCTCTAGTGA AAGGTCTCTC ATGGAGCTTT TACCAGAAAG CATGTCCAAA AGTGGAAAGC ATCATCAGGA  AAGAGCTCAA GAAAGTCTTC AAGAGAGACA TTGGTTTAGC CGCAGCCATC CTTCGCATAC ATTTCCATGA CTGCTTCGTT CAGGGATGTG AAGCATCAGT GCTGCTAGAT GGATCAGCGA  GTGGACCAGG AGAGCAATCA TCGATCCCGA ATCTGACACT CCGTCAAGCC GCCTTTGTCG TCATCAATAA CCTTCGTGCC CTCGTCCACA AGCAGTGTGG TCAAGTCGTC TCTTGCTCTG  ACATCCTCGC TCTAGCCGCC CGTGACTCCG TCGTACTTTC AGGAGGGCCA GACTATGCTG TACCACTTGG CCGACGCGAC TCACTAGCAT TCGCGAGCCA GAACACAACG TTAAACAACT  TGCCGCCACC ATTCGCCAAC GCGAGCCAGC TCATCGCCGA CTTCGCCAAT AGAAACCTCG ACATCAACGA CTTGGTTGCA CTCTCCGGTG GACACACCAT CGGGATCGCG CATTGTCCGT  CTTTCACAGA CCGTCTCTAC CCGAACCAAG ACCCAACCAT GAACAAGTCC TTCGCCAACA ACCTTAAACG CACTTGCCCC ACCGCTAACT CGAGCAACAC GCAAGTGAAT GACATAAGGA  GCCCTGACGT GTTTGACAAC AAGTACTACG TTGATCTCAT GAACCGACAA GGGCTGTTTA CATCAGACCA GGACCTGTTC ACGGACAAGA GGACACGTGG TATCGTGGAG AGCTTTGCCA  TCGACCAAAA GCTGTTTTTT GATCATTTTG TGGTGGGGAT GATCAAGATG GGTCAGATGA GTGTCTTGAC GGGGTCACAA GGAGAGATTC GTGCAAACTG TTCCGCTAGA AACACTGAAA  GTTTCATGTC TGTTTTGGAA GAAGGCATAC TCGAGGAGGC TCTTTCCATG ATCTAGATGA AACCATATAA AATATCGCCT CTTATTTTCC TTTGACTTTG TTTTTTTTAG TTGACGCACT 
TGTGGTTTGT GGAATGCTTT AAGACTATCT GATAAATAAG AGTGTTGCTT CATCTTAGCT TTGTTTTTAA GTTCATGCAC GTATGCTTAA TCTGTGGAAT GTTCGAGA 

Retrieve as FASTA