Entry information : HaGPx04 (HanXRQChr01g0002361)
Entry ID 3071
Creation 2006-05-19 (Marcia Pinheiro Margis)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGPx04 (HanXRQChr01g0002361)
Name (synonym) HaGPx04 (HanXRQChr01g0002361)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGPx04
start..stop
S start..stop
NtGPx05-1B 279 4e-98 1..167 1..167
NtGPx05-1A 275 1e-96 1..167 1..167
StGPx05 270 2e-94 1..167 1..167
EgrGPx09 268 1e-93 1..167 1..167
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9286515..9286568 54 N° 2 9286327..9286403 77 N° 3 9285170..9285231 62 N° 4 9284147..9284265 119
N° 5 9283723..9283890 168 N° 6 9282915..9282947 33  
complement(join(9282915..9282947,9283723..9283890,9284147..9284265,9285170..9285 231,9286327..9286403,9286515..9286568))


exon

Literature and cross-references HaGPx04 (HanXRQChr01g0002361)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L., Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison ,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project.
DNA ref. HanXRQ genome:   HanXRQChr01 (9286568..9282915)
Cluster/Prediction ref. HanXRQ:   HanXRQChr01g0002361 UniGene:   Han.6693
Protein sequence: HaGPx04 (HanXRQChr01g0002361)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   18814.67  
PI (pH):   %s   9.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAAPSVPENSIHEFTVKDAKGKDVDLSIYKGKVVLIVNVASKCGFTNSNYPKMAELHVKYRDGFEILAFPCNQFLYQEPEASEKVEEFACSRFNAEYPIFQIRVNGPKAAPLYNFLKAKKGGFCGSRIKWNFTKFLVDKEGQVIGRYGTSTSPLSIEGDIQKALNAQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic, 2 ESTs (TIGR TC14681) and 4 ESTs from Unigene (BU017007, CD848888, DY920274, DY919597). Cultivar="RHA280" and "ANN1312".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCAGCTCCATCTGTTCCTGAAAACTCAATCCATGAGTTCACTGTCAAGGTGGTATTATTATTTTTACATCTTTATAATATTTATATATTTATATTTATAGTTTTGAATATTGAG
TTTTGTTTTGTTTTGAGGGATTATTTGATTGAATTTTGAGTGCAGGATGCCAAAGGGAAGGATGTGGATCTGAGTATCTACAAAGGAAAAGTTGTTTTGATTGTTAATGTTGCTTCCAAA
TG
GTTGTTTCTGTTTCTGTTCTGTGTCTTGTTTTTTGGTTTTTTTGGTTTTTTGGGATTTGGGTTTATGCAATGTTTTAAAAACCGGTTTTTAAATCATACTGGGTGGGTTAGGCTCATG
GTTCAATCGGTTGAACCGGATTGACTAATTAACCCTGTAAATCCATGAAATACGATTTCAACTCAAAAAATAATCCAAAGTACATCATCCCATCATAAAAAAATAGGCAAATTGGATTTA
AGTAATCCTAACCGATAATAATCCCAACTCAGTTGTTTGCTGATAATAATCCGAACCGGTCCACTTTTGGCCGATAATAGTCTGCGTTAAAAATAGCTTAACGGAGTTAAGTTTTTTTCC
GAATTACAAACCGATGTTTTAGGGCTTTTGATTAGAACGTGGATACAAGTTAATTGATGTAAAATTTACCTCGAAATATTGTCCAAAACGACGAAAACGGTGCTTCAATTCGGGTGTCAA
AACTTCCAATTAACAAAAATCAAGCCGTTTGGAGCACCGTTTCGAGGTAAGTTTTACATAAATCGACTCGTATCCCTGTTCTGATTAAAATCCCTAAAACATTGGTTATCGGAAAAAACT
TAACTCCGTTAAGCTATTTTTAACGGCAGACTATTATCGACCAAAAGTGGACCAGTTCGGATTATTATCGGCAAATAACTGAGTTGAGATTATTATCGGCCAAATTGAGAAAGTTGGGAT
TATTTAAATCCAATTTGCCTAAAAAATATTCCAAAAGCTAATCCATAATAAATAAATAACCCAATGTTCGATGTGAATTGTGGATGAATTTTGATTGATGTGGATTGTGGGCGCTAGGTT
TAACTAAGAATGTAAATCGTCACCTTTTTGGGCCCATAAAAGATTAAAAGTCCAAATTTTAACCTTGGTACTGGTATAACCCAATTTACCGGTGGTACAGCTTCTTTGCCGTTCCCTTAG
TTTACCGGTGTGATTCGAGCCAGGCAAGCTTCCGGCATCCGGTTGGTTTAAACCGGTTTTTAAAACCATGGGTTTATGTGTGATTGTTTTGTGTTTTGTTCTAATTGTTTGTTTATTGTT
TTGTTGGGTTGGATTAGTGGGTTTACAAACTCGAATTACCCGAAAATGGCTGAGCTTCATGTGAAGTATAGAGATAAAGGTATGATTTCACTTGTCAAAGCTTTACATCTTCACTAAATG
TTAGTGATTTTTTTTACTAATTTTGGTGATAATGAATTAATTAATTAAAGGCAAACCGGATTTAAATAATCCGAACGGGCTGTTTTTTGGACAATAATAACCCCAACTGAGTTTATTCCT
GACCGTGGTCTAATCTTTTTCATTTTGTTTGTATAATGGTCCGCCGTAAAAAATAACTAAACGGAGTTAAGTTTTTTTTTCCAAATTACAAACCAATGTTTTAGGGCTTTTGATCAGAAC
GAGGATACGAGTTGATTGATGTAAGACTTACCTTGAAACGGTGCTCCAAACGGCTTGATTTTTGTTAATTGAAAGTTTAAACACCCAAATTGAAGCACCGTTTTCATCGTTTTGAGCACT
GTTTCGAGGTAAATTTTACGTCAATCGACTCGCATCCTCGTTCTGATCAAAAGCCCTAAAACATCGGTTTCTAAATTTGGAAATTAGAAACAGTTTTACATAATTACCTATGCAGTTAAT
ATCGGTGATTTATCGGTCCTCTAGTAGAATATCAGTACCAATATTATCGGCGATATTTGACCGAAATCACCGATATATCACTGAATTGTTAATTATAAATTGCTGTGTATATAAATTCTG
CATGATATTAAAATTACCGATGTCCCACCGCGATAACCTATATCTGAAATATCGGTCCTTGACCGATATCCGTTATTTTACTGTACTAACTGCATAGAATTGTATTGTCAAAAGAATACA
AAAAATTAAAATTCATCATTATAGTACATGCCCATATGATAAAATTATTGCTATGACAGTTGTAGCTTCACAAATTTGTTATGCTTATAGTAAAAAAAAATATATATATATCTATAGTAA
CATGTTCTAGTAACAATCATCAGGTTTCGAGATCCTGGCATTTCCATGCAATCAATTCTTGTACCAAGAACCTGAAGCAAGTGAAAAGGTGGAAGAATTTGCATGTTCGAGGTTTAACGC
TGAATATCCCATCTTCCAAAAG
GTTAGTATTCGATAAAATTCTATGTTACTTCAGCCATATAAAGCACATCATCCGAAACACCTACAAAGAGATCTGAAATGTAAAAACAATCGGTTGGT
TTGCAAGACCATTTTCATAGGAGAATTGTGGATCTTTCGAGTACCAAAAATCTTATTATGCGTTCTCTTGTGCGTGTATGCATGATCAACTATGGAACCATGGCATGTTTGACTTTCAAA
ACGGTCAAATTGTTTATCTTCGTTTGGTTTTTTTGAAGATTCGTGTCAACGGGCCTAAGGCAGCGCCTTTGTACAACTTTCTTAAAGCCAAAAAAGGAGGGTTCTGCGGGTCTAGAATCA
AATGGAACTTCACAAAGTTTCTTGTGGATAAAGAAGGCCAAGTCATAGGTCGTTATGGAACATCTACTTCACCGTTATCAATCGAG
GTAACTTGTCCCCCCCCCTTTTTTATTTTTTGTT
TGAGTAATGTATCCGAATGATCCCTGTGGTTTACCAAAATTTTGGATTTGTTCCCTAGTTTTCCAAAAGTACATGGATGGTCCTGTGGTTTGCACTTTGTAACGCCTTTAGTCCCCAGGT
TTTTCCGAAAGTACACGGATGGTCCCTGCGGTTTGCACTTTGTAACGCGTTTCGTCCCTAGGTTTTTCCGAAAGTACATGGATGGTCCCTGCGGTTTGCACTTTGTAACGCGTTTCGTCC
CTAGGTTTTTCCGAAAGTACATGGATGGTCCCTGTGGTTTGCACTTTGTAACGCATTTAGTTCCTAAATTGGACCTGCTAAAACCTTTAGATTTGTTTGCCGGGGACTAAATGCGTTACA
AAATACAAACCACAAGGACCATCCGTGCATTTTTTAAAAACCAGGGACAAAATCCAAAATTTTGGTAAGCTGCAGGGACCATCCGTGTACTTTACTCTTTTTGTTTCTTCTCCGATCAAA
TTTGGCAGTTACTTAAAAATGGGCCGATTCGGGTTTAATGTTTTGACTAACTAACAAGTAAATTTACAGATAAATATTAAAATGTTTTGACTAACTAACAAGTAAATTTGCAGATAAATA
TTAAAAAATAGCTTAAAGGGAAACGGGTCAAAAGTTGTCCAAAGTTCAGTATATATTTTACAAAAATAGATGTTTTGGGTCAAGTCAATTTGTACAAAAATTTAATCGGTAACGGTTCTA
GCCTCATTAATTTCATTACAGGGTGATATTCAAAAGGCGTTGAACGCTCAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCAGCTCCATCTGTTCCTGAAAACTCAATCCATGAGTTCACTGTCAAGGATGCCAAAGGGAAGGATGTGGATCTGAGTATCTACAAAGGAAAAGTTGTTTTGATTGTTAATGTT
GCTTCCAAATG
TGGGTTTACAAACTCGAATTACCCGAAAATGGCTGAGCTTCATGTGAAGTATAGAGATAAAGGTTTCGAGATCCTGGCATTTCCATGCAATCAATTCTTGTACCAAGAA
CCTGAAGCAAGTGAAAAGGTGGAAGAATTTGCATGTTCGAGGTTTAACGCTGAATATCCCATCTTCCAAAAG
ATTCGTGTCAACGGGCCTAAGGCAGCGCCTTTGTACAACTTTCTTAAA
GCCAAAAAAGGAGGGTTCTGCGGGTCTAGAATCAAATGGAACTTCACAAAGTTTCTTGTGGATAAAGAAGGCCAAGTCATAGGTCGTTATGGAACATCTACTTCACCGTTATCAATCGAG
GGTGATATTCAAAAGGCGTTGAACGCTCAGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTAGAAGAAA AGTCAATATA TTGCAATCAA TTCCCAGAAG ACATTTGCTG GCCATTTCAA CCACCTTCCC TTCATTCCCG TGCACCTGTC TAATTCAATC TAAAAAACCC ACCCTCTTCA  CCATCACTTC CGTTAACTTT AACGGTAACA TCTCAAATGG GTGCAGCTCC ATCTGTTCCT GAAAACTCAA TCCATGAGTT CACTGTCAAG GATGCCAAAG GGAAGGATGT GGATCTGAGT  ATCTACAAAG GAAAAGTTGT TTTGATTGTT AATGTTGCTT CCAAATGTGG GTTTACAAAC TCGAATTACC CGAAAATGGC TGAGCTTCAT GTGAAGTATA GAGATAAAGG TTTCGAGATC  CTGGCATTTC CATGCAATCA ATTCTTGTAC CAAGAACCTG AAGCAAGTGA AAAGGTGGAA GAATTTGCAT GTTCGAGGTT TAACGCTGAA TATCCCATCT TCCAAAAGAT TCGTGTCAAC  GGGCCTAAGG CAGCGCCTTT GTACAACTTT CTTAAAGCCA AAAAAGGAGG GTTCTGCGGG TCTAGAATCA AATGGAACTT CACAAAGTTT CTTGTGGATA AAGAAGGCCA AGTCATAGGT  CGTTATGGAA CATCTACTTC ACCGTTATCA ATCGAGGGTG ATATTCAAAA GGCGTTGAAC GCTCAGTGAG ATCAATGAAC TAGTCAAGTT CTCTTAAAAG TGAAGGTAAG CAAGATCCCT  ACAATCATAT CAGTACGAGA CCCGTCTACA GAAACGTGCT TTTTAGTGGT ATAGCATAGC TGTGTAAAGG TGAACCGTGA TGCTTGAGAG TTAAAGATAT TGGTTTGATA TGTGCGGTTT  CTAAGGATGA TTTCGGTTGT ATTGTTCTTA TTTATTTATT ATAATTATGT TGGTTGTTTA ACAACGTGAA AGCAGAAGAC AAAGCTTGTG AATATTCATC GTTTCCAGGG GCGCAACTAT 
TAGGGG 

Retrieve as FASTA