Entry information : HaGPx02 (HanXRQChr07g0186121)
Entry ID 3072
Creation 2006-05-16 (Marcia Pinheiro Margis)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGPx02 (HanXRQChr07g0186121)
Name (synonym) HaGPx02 (HanXRQChr07g0186121)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGPx02
start..stop
S start..stop
CclGPx02 304 8e-107 8..204 9..204
NtGPx02 290 6e-102 40..204 3..167
CsGPx02 290 2e-101 8..194 9..194
LeGPx02 286 2e-100 40..204 3..167
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2556513..2556668 156 N° 2 2555685..2555761 77 N° 3 2553366..2553427 62 N° 4 2553148..2553266 119
N° 5 2552394..2552561 168 N° 6 2551831..2551869 39  
complement(join(2551831..2551869,2552394..2552561,2553148..2553266,2553366..2553 427,2555685..2555761,2556513..2556668))


exon

Literature and cross-references HaGPx02 (HanXRQChr07g0186121)
Literature Michelmore,R.W., Knapp,S., Rieseberg,L., Bradford,K., Kesseli,R., Boore,J., Kozik,A., Matvienko,M., Lavelle,D. and Lai,Z. Sunflower (Helianthus annuus) ESTs (set 2) from the Compositae Genome Project http://compgenomics.ucdavis.edu/.
DNA ref. HanXRQ genome:   HanXRQChr07 (2556668..2551831)
Cluster/Prediction ref. HanXRQ:   HanXRQChr07g0186121 UniGene:   Han.6776
Protein sequence: HaGPx02 (HanXRQChr07g0186121)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   206
PWM (Da):   %s   23265.04 Transmb domain:   %s   i7-24o
PI (pH):   %s   8.76
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTTTVTNLTSFLLVGLAIFLFYRHPSSSLTPNIMSQQQQTPKSVHQFTVKDIRGNEVSLSSYKGKVLLIVNVASKCGLTESNYKELNILYQKYKDDFEILAFPCNQFLRQEPGTNEEIQETVCTRFKAEFPIFDIDVNGNNAAPLYKFLKSEKGGFLVDGIKWNFTKFLVNKEGKVIQRYGPRTPPLEFEKDIQDLLSSSSS*

Retrieve as FASTA  
Remarks Complete sequence from 1 EST (TIGR CD850751) and 10 ESTs from NCBI CD850751, DY925321, DY914684, DY924063, DY923099, DY922433, DY922433, DY915293, DY950984, CF096564. Strain="ANN1312".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTACAACAACAGTCACAAATCTGACCTCTTTTCTCCTTGTGGGTCTCGCTATTTTCTTGTTTTACAGACACCCTTCTTCTTCTCTCACTCCAAACATCATGTCTCAACAACAA
CAAACCCCCAAATCCGTTCACCAATTCACCGTCAAG
GTAACTCCTAATCGATTCATGTGTTTATCTTCTTGATTCTTACTTCAAAGTGATTACTTTTTAGAGTAAAATGGTCCTGAGATT
ATATATCACTTTTGCCACTTGTTACAAAGACAAAAAAGAATTTTTTTGTATCCGGGTCGGTTTCATTTTTGTTGTCATTTTCATCGTATCGGCAAGTTAGAAATTTCTGCCCTTTTTGTC
CTTTTTCTCGTTTAAACGGTGGTGTTTCTGATGGAGTTCATACATAATATGACGATTATACCCTTTATTTTTTTAAATGGAATTTCTTTGTCATCATTGTATATTAATTATTTTTCGTGT
TATGAATTTACATCGAGATAGTTGATAAACGGGTTTGCTACCCCTTTTTTAATAGCAAAACTAAGTCTTTAAATGAGTAAAATGACTAAAAGGCGATAAATTTCTAACCCAGCTTACCAA
TTGGATAGAAATGGCAATAAAAATGAAACCTAATGGATCCATATATAAAAAGTTTTATTTTTGATCAAAGTGGGTAAAAAAAACCTAAACTCAGGCACTATTTTGGCATTTTACTCTACT
TTTTATATAGATATTTGAAGAATATATGTAATAATGTAATTGGGTTTAGTTTTAGTTACAAAATTGGTGTAGAAAAAATCTGAGAATTTGAAAAAAAAAAGTCAAACTTTGACTTTATAT
GATCCTTTGAATTGTGGAACTGTGGAAGTATGAATTTATATGGGTTTATTGTGAATTATTTTTGTAGGATATTCGCGGAAATGAGGTGTCATTGAGCTCTTACAAGGGGAAGGTTCTTTT
GATTGTTAATGTTGCATCTAAATG
GTAAATAGCTCGATTTTTGGTTATACTTTTTTTTAGGGTGTACCTATTGGCACACCCAAATGCCTATATGCACACCAAAAAGGGCTTTTTTGTCCT
ATATGCACACCCTGCAGTGTCGAGCTGTGGCCAAGCGCGACGTTTTGGTCCGGTCAACCAGACAAAAGATTGACGGGTCTGTTGACCGGATCAAAACGCCGAGCTTTGGCTGCGTTTTGG
TCCTGTCAACCAGACAAAAGACTGACCAGGTGTCTGGTAGACAGGACCAAAACTGGCCAAAGCTCGGCGTTTTGGTCCGGTCAACAGACCCGTCAGTCTTTGTCTGGTTGACCGGACCAA
AATGCCGCGCTTTGAGTATCATAAATCAAGCATGCAAAAAAACTTGTTGGTAGTCACTAAAAGTATGATATTGTCAAGATTTTGGTTTAGAAGTGTCTTTGATTATCATAAATCAAGCAT
ATAAGATGATAAGAACACTGTTCAGTTTATAACTAGTAATTAACAGTCTGATTCTGATCATGTAATTTAGTTCAAAGAAAAACCGAAGCAGATTTTTATATTATTGATGATCTATGTTTT
TCATACTTTCATAATTTGTAGTGTATTTCTTGATTTTCTTTAATTAGTTGATTACTATGATAAGCAGTGGAGTAATCTCGTCTGCTGATAAATTCGCTTTCGGTTTCCTTATTTCTGTAT
TTTAGCTCTCTTACAAGTTACATAACCTGCAAAACTTAATTAATAAAAATAAGAGTAAATTACGATTTTGGCACCTGTGGTTATATCACTTTTACCCTTTTAACCCAAAAAAGATTTTTT
TTAACATCTGAGCCCCCAACGTCTTTTTTTCTAACCTTTTTGGCCCCTAACGTCTTTTTTCTAACCCTTTTGGCCCCTAACATTTAATGGATGGGGTTAGTGTTAGGGGCCAAAAGGGTT
AGAAAAAAAGACGTTGGAGGCGCAGATGTTAAAAAATTCTTTTTTGGGCTAAAAGTGTAAAAGTGATATAACCACAGGGGCCAAAATCGTAATGTGGGAGTATGTAGTTCTTGATCAAGA
AATTCAAGACGTATCTCGAGTTTGTTACATCATTATTATGGCATTTATTTTTTTCTGATGTATAGTTGAAATAAACAGTTGGGTGATTATGGTTGAGGATATCCTTATCTTCTTAATTTA
TTTATTACATGTATGTATGTATGTCAGCTGCAAGACTAATGTCATTACTACCTCCATATCGGAAGAGTCCACGTTTGACTTATGAAAGTCAAATACATCATCTTTTAGTTTTGAAATCAT
CAAACATCAGGGCCTTTTGTGTATAGTAATTTTGTTAGTACATTAAATTGTATTTTCGATGTGAAATGTCGGACATTAATGTTTTTTTCTCAGTCCCATGATCCGAGTCGAGTTCTGACC
TTTAATGGTCAAAATGATATAACCTATTAACTTAAAGGTTGATAAAATTCTGCTTTGAGTAAACTGCCATTTTTGGTCCCTGTGGTTTGGTTACTTTTGCCACTTTAGTCCAAAATTGAA
ACCTTTTGCATCTGGGTCCCTGTGGTTTCAGTTTTATTGCCATTTTGGTCCAAAAATGAAATTAGGTCATATTTGTCTTATAAAATCCTGTAATTTTGTCCTTTACCTCATGGGCAAATC
AGGTCATATTTGTCTTATAAAATATGGTATTTATTTATAAAAAAGAAATGACCATTTTGCTTATGCGGAAAAGGACAAAATAGCAGGATTTTATAAGACAAATATGACCTGATTTCATTT
TTGGACCAAAATAGCAATAAAACTGAAACCACAGGGACCCAGATGCAAAAGGTTTCAGTTTTGGACTAAAGTGGCAAAAGTAACCAAACCACAGGGACCAAAATGGCAGTTTACTCTTCT
GCTTTTATAACAGAGAAAAAAATCCAAAAGCACCTTAAACTATCAGAATAATTACAAAATAGAACAAACTGGCACCAAAAACTCACATTAGTTAATTTAGTTGGCAAACTCCAACACCGT
TATCCATTTAATTGTCTATAAAACCAGTGGCGAAGCTTGCCCTCGAAAACCGGGGGGGGGGGGGGGGGGGGGGGGCTTTCTATACGAAAACTACATATATAACACTACTGAGCGAAAAAT
TCGCCCCCCCCCTCCGGCCCCACTTATCCTGCGCCCCTGTTTAAAACTCACTTGTTTGGTTTAGTAACACTATACAACTTTTTTTCCTGTAATTAGTATCTAATCCTTTCGTTATATATA
GTGGACTAACGGAGTCAAACTACAAAGAGTTGAATATATTGTACCAAAAATACAAAGATCAAGGTACGTTTATCGTTATTGTGCATGAACTAGATCCATTTTTTCTGATAATTTAAACGG
TTTCATGGTTTTGATGTATGTGACTTTCATATTTGTTGGCAGATTTTGAAATCTTGGCTTTTCCATGCAACCAGTTTCTTAGGCAAGAGCCAGGAACAAATGAAGAAATTCAAGAGACCG
TATGCACGAGATTCAAAGCCGAGTTCCCGATATTTGACAAG
GTATTCTTTGATGGTTCAGTTTTCAAGCAAAGTTCTTTATAGAGTAAAATGTGATTTTTCGTCCCTGAGGTTTGGCCAC
TTTTGAGACTTTCGCCCAAAGGTTTGTTTTCCCGCATCTGGATCCAAAAAGTTTGCTCGTTAACTCCCATCCATTTTTCTCTGTTAAGTCAGGGGCATTTTGTCTTTTTTGTTGACTTAA
AGGGCGATTCGGTCTTTTTCACTTTATGTAAAAAGACTGAATACCCCTAAAAAAGAGCAAATTGCCCTTAAAGTTAACGAAAAAGATAGAAATACCCCTGAATTAACGAAAAAAATGGAC
GGAGTTAACGAGCCGGATGAAAATGGTGGGATTTCAAACCTTTTAGATCCAGATGCGGAAAAACAAACCTTTGGACGAAAGTCGCAAAACTGGCCAAACCTCGGGGACAAAAAATGGCAT
TATTGCACATTCCATTTTCAAAATCTTCGAAAAAGAAAGAAACTTTGCAACGAGTATGAGATATTCAAAACTGTAAATTGTTGCAATATTGAAGAGATAGAAGGAGAAATTTGTATATCT
AAAAGAAACAATCTTGGATCGTTGCAGATTGATGTCAACGGAAACAATGCAGCACCCCTTTACAAGTTTTTAAAATCCGAGAAAGGTGGTTTCTTGGTTGATGGCATAAAATGGAACTTC
ACCAAGTTCTTGGTGAACAAAGAAGGAAAAGTTATCCAAAGATACGGTCCTCGAACCCCGCCTCTAGAATTCGAG
GTTAGTTTGAAAAAGGAAGAGTAAAATGCCGTTTTCGTCCCTGAG
GTTTGGCCAGTGTTGCGACTTTCGTCCAAAGGTTTGTTTTTTCGCATCTGGATCCAAAAGATTTGAAATCTTGTCATTTCATCCAGCTTGTTAATCCATTTTCTCCTTTAAGTCAGGGGT
ATTTCCGTTTTTTTTTCGTTAACTTAAAGGCCAATTCGGTCTTTTTCACTTTATGTAAAAAGACCGAATACCCCTAAAAAAGACTGAATTGCCCTTTAAGTTAGCAAAAAAGATAAAAAT
ACCCCTGACTTAACGGAGAAAAATGGATGGAGTTAACGAGCCTGATGAAAATGGCAAGATTTCAAACCTTTTGTATCCAGATGCGGAATAAACAAACCTTTTTACTAAAGTTGCAAAACT
GACCAAACCTCAGGGACGAAAATGGCATTTTACTCAAAAAGAAAAACGCAAAATATAGGTTTTGGTTTCTGGGAATCTGGGTTACTGATTTCTTGAATTGGTTCTTTGATAATGTACAGA
AAGATATTCAAGATCTGTTGAGTTCGTCATCATCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTACAACAACAGTCACAAATCTGACCTCTTTTCTCCTTGTGGGTCTCGCTATTTTCTTGTTTTACAGACACCCTTCTTCTTCTCTCACTCCAAACATCATGTCTCAACAACAA
CAAACCCCCAAATCCGTTCACCAATTCACCGTCAAG
GATATTCGCGGAAATGAGGTGTCATTGAGCTCTTACAAGGGGAAGGTTCTTTTGATTGTTAATGTTGCATCTAAATGTGGACTA
ACGGAGTCAAACTACAAAGAGTTGAATATATTGTACCAAAAATACAAAGATCAAG
ATTTTGAAATCTTGGCTTTTCCATGCAACCAGTTTCTTAGGCAAGAGCCAGGAACAAATGAAGAA
ATTCAAGAGACCGTATGCACGAGATTCAAAGCCGAGTTCCCGATATTTGACAAG
ATTGATGTCAACGGAAACAATGCAGCACCCCTTTACAAGTTTTTAAAATCCGAGAAAGGTGGTTTC
TTGGTTGATGGCATAAAATGGAACTTCACCAAGTTCTTGGTGAACAAAGAAGGAAAAGTTATCCAAAGATACGGTCCTCGAACCCCGCCTCTAGAATTCGAG
AAAGATATTCAAGATCTG
TTGAGTTCGTCATCATCTTAA

Retrieve as FASTA