Entry information : PtPrx09 (POPTR_0012s03980 / Potri.012G042800)
Entry ID 3087
Creation 2006-06-01 (Claudia Cosio)
Last sequence changes 2006-06-01 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: PtPrx09 (POPTR_0012s03980 / Potri.012G042800)
Name (synonym) PtPrx09 (POPTR_0012s03980 / Potri.012G042800)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx09
start..stop
S start..stop
PtrtrPrx16 601 0 1..322 1..323
MePrx73 520 0 1..322 1..323
MePrx66 516 0 1..322 1..323
MePrx130 516 0 1..322 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3862067..3862273 207 N° 2 3861710..3861898 189 N° 3 3861459..3861624 166 N° 4 3860950..3861356 407
complement(join(3860950..3861356,3861459..3861624,3861710..3861898,3862067..3862 273))


exon

Literature and cross-references PtPrx09 (POPTR_0012s03980 / Potri.012G042800)
Literature DOE joint genome institute.
DNA ref. Phytozome 12:   Chr12 (3862273..3860950)
Cluster/Prediction ref. JGI gene:   728957
Omic ref. ePlant:   Potri.012G042800
Protein sequence: PtPrx09 (POPTR_0012s03980 / Potri.012G042800)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (301)
PWM (Da):   %s   34762.6 (32610.5)  
PI (pH):   %s   8.09 (7.99) Peptide Signal:   %s   cut: 22 range:22-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTAFIFACVAVLTVVGVCQAGDLRKDFYRTSCPAAESIVKNITETRAASNPNLPAKLLRMHFHDCFVRGCDASILINSANSTAEKDAIPNLSLANFDVIDEIKTELENKCAGKVSCADILALAARDAVSFQFKKPMWEVLTGRRDGNVSVASEVLTNIPSPFLNFSSLVQSFKSKGLTVHDLVVLSGAHTIGVGHCNLFSNRLYNFTGKADQDPSLNSTYAAFLKTKCQSLSDRTTTVEMDPGSSQNFDASYFVILKQQKGLFQSDAALLTDKTSSNIVGELVKSTDFFKEFSQSMKRMGAIGVLTGNSGEIRKTCGVINS

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (3 introns). Only ESTs from various hybrids. Contig also contains PtPrx10.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTGCTTTTATTTTTGCTTGTGTAGCAGTCTTGACAGTTGTTGGGGTTTGTCAGGCTGGTGATTTGAGGAAGGACTTCTACAGGACCTCTTGCCCTGCAGCTGAGAGCATCGTC
AAAAATATCACTGAAACACGTGCTGCAAGCAACCCCAACTTACCTGCAAAGTTATTGAGAATGCATTTTCATGACTGCTTCGTAAGG
GTAAGCAACGCTTAAATATTCATTCTGCTGTTA
GAAAAATAGTATCTGTAGCTTTGTCCATGCGTGGATATTGTATGCTTGAAAATAAAAGAAAAACACCATCTAGTATCGCCACATTTTGTAATTCTAATGCATATATCTAGCTAATTCGAA
ATTAAATTCCTGCAGGGTTGCGATGCCTCCATTTTAATAAACTCAGCAAATAGCACAGCGGAGAAAGATGCAATTCCAAATCTATCTTTGGCAAACTTCGATGTTATTGATGAGATTAAA
ACGGAGCTAGAGAACAAATGTGCAGGAAAAGTATCCTGTGCTGACATTTTGGCTTTGGCTGCCAGGGATGCGGTCTCATTCCAG
GTAAATATCGCAAATAAACATTCTTAATCTCAACTC
AAATGATCATGCATGTAATCACAGCGAACATATACGATTCTTCCTGCAGTTCAAAAAACCAATGTGGGAAGTGCTTACTGGTAGAAGAGATGGTAATGTGTCAGTAGCTTCGGAGGTCCT
GACAAACATTCCTTCCCCATTCTTAAACTTTTCCAGCCTCGTTCAAAGTTTCAAGAGCAAGGGTCTAACTGTTCATGATCTCGTTGTACTATCAG
GTATACTTACATATTATACTCAAGA
AAGTAATGGCACATACTTCTCAAGGGTTATATAACTGAGCAGAATCTCTTATCACTTTTGAATCATACTGTATGTAGGGGCACATACCATTGGTGTTGGCCACTGCAACCTGTTCAGCAA
TCGACTCTACAACTTCACAGGAAAAGCAGACCAGGATCCTTCTTTGAACTCAACATACGCTGCTTTCTTAAAGACCAAATGCCAAAGTCTTAGCGACAGAACCACCACAGTAGAGATGGA
CCCTGGCAGCTCTCAGAATTTCGATGCTTCCTACTTTGTTATCCTTAAACAGCAAAAGGGTCTCTTCCAATCTGACGCAGCCCTTCTAACAGACAAAACTTCGAGTAATATTGTTGGAGA
GCTGGTTAAATCAACTGATTTTTTCAAAGAATTCTCCCAGTCAATGAAAAGAATGGGAGCAATTGGGGTTCTTACGGGCAACTCAGGGGAGATCAGAAAGACGTGCGGCGTTATCAATTC
CTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACTGCTTTTATTTTTGCTTGTGTAGCAGTCTTGACAGTTGTTGGGGTTTGTCAGGCTGGTGATTTGAGGAAGGACTTCTACAGGACCTCTTGCCCTGCAGCTGAGAGCATCGTC
AAAAATATCACTGAAACACGTGCTGCAAGCAACCCCAACTTACCTGCAAAGTTATTGAGAATGCATTTTCATGACTGCTTCGTAAGG
GGTTGCGATGCCTCCATTTTAATAAACTCAGCA
AATAGCACAGCGGAGAAAGATGCAATTCCAAATCTATCTTTGGCAAACTTCGATGTTATTGATGAGATTAAAACGGAGCTAGAGAACAAATGTGCAGGAAAAGTATCCTGTGCTGACATT
TTGGCTTTGGCTGCCAGGGATGCGGTCTCATTCCAG
TTCAAAAAACCAATGTGGGAAGTGCTTACTGGTAGAAGAGATGGTAATGTGTCAGTAGCTTCGGAGGTCCTGACAAACATTCCT
TCCCCATTCTTAAACTTTTCCAGCCTCGTTCAAAGTTTCAAGAGCAAGGGTCTAACTGTTCATGATCTCGTTGTACTATCAG
GGGCACATACCATTGGTGTTGGCCACTGCAACCTGTTC
AGCAATCGACTCTACAACTTCACAGGAAAAGCAGACCAGGATCCTTCTTTGAACTCAACATACGCTGCTTTCTTAAAGACCAAATGCCAAAGTCTTAGCGACAGAACCACCACAGTAGAG
ATGGACCCTGGCAGCTCTCAGAATTTCGATGCTTCCTACTTTGTTATCCTTAAACAGCAAAAGGGTCTCTTCCAATCTGACGCAGCCCTTCTAACAGACAAAACTTCGAGTAATATTGTT
GGAGAGCTGGTTAAATCAACTGATTTTTTCAAAGAATTCTCCCAGTCAATGAAAAGAATGGGAGCAATTGGGGTTCTTACGGGCAACTCAGGGGAGATCAGAAAGACGTGCGGCGTTATC
AATTCCTGA

Retrieve as FASTA