Entry information : PtPrx17 (POPTR_0008s10270 / Potri.008G103200)
Entry ID 3094
Creation 2009-01-28 (Christophe Dunand)
Last sequence changes 2009-01-28 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: PtPrx17 (POPTR_0008s10270 / Potri.008G103200)
Name (synonym) PtPrx17 (POPTR_0008s10270 / Potri.008G103200)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx17
start..stop
S start..stop
MePrx62 541 0 1..337 1..335
RcPrx48 535 0 5..337 6..337
CclPrx118 508 0 5..337 6..335
VvPrx19 505 0 1..337 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6544051..6544299 249 N° 2 6543760..6543951 192 N° 3 6543504..6543669 166 N° 4 6543017..6543423 407
complement(join(6543017..6543423,6543504..6543669,6543760..6543951,6544051..6544 299))


exon

Literature and cross-references PtPrx17 (POPTR_0008s10270 / Potri.008G103200)
DNA ref. Phytozome 12:   Chr08 (6544299..6543017)
Omic ref. ePlant:   Potri.008G103200
Protein sequence: PtPrx17 (POPTR_0008s10270 / Potri.008G103200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (319)
PWM (Da):   %s   36045.77 (34095.7)  
PI (pH):   %s   4.15 (4.11) Peptide Signal:   %s   cut: 19 range:19-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMGLAICFMMLIKLVIALAKIPTTLNTTCVGDIGVLLQFDVYQESCPEAEPIILSWVQSAISEEPRMAASLLRLHFHDCFVNGCDASVLLDDTENFVGEKTAPPNLNSLRGFEVIDAIKSDLESVCPETVSCADILAIVARDSVLLSGGPGWEVQMGRRDSLTASKAAATNNIPAPNSSVATLVANFQNVGLTQNDMVALSGAHTMGKARCSTFSSRFQSPSNSGGPDVNMDFVQSLQQLCSETADSTTTVAHLDLVTPATFDNQYYVNLLSGEGLLPSDQVLVVQDDRTREIVESYAEDPLLFFEDFKNSMLKMGALGPLTGDSGEIRVNCRAVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATGGGCTTAGCCATTTGTTTTATGATGCTTATTAAGCTTGTAATTGCGTTGGCAAAGATACCAACCACCTTGAACACAACATGTGTGGGTGATATTGGTGTCTTATTGCAGTTT
GATGTTTACCAAGAATCCTGCCCAGAGGCAGAACCTATTATACTATCTTGGGTTCAAAGTGCAATCTCCGAGGAACCACGAATGGCAGCTTCCCTGCTTCGTCTTCACTTCCATGATTGC
TTTGTTAAT
GCAAGTCAAGTTTAATTTCAGAATTATACATATTGCTTCTATTTATCACAGCTTCTATTGTAATTGCAATGATCATGATGCACATTATGTGTTTTGCAGGGATGTGATGCT
TCAGTGCTGCTAGATGATACTGAGAACTTTGTGGGTGAAAAAACTGCACCACCCAACTTGAATTCACTAAGAGGGTTTGAAGTGATTGATGCCATTAAATCTGATCTGGAATCTGTTTGT
CCTGAAACAGTTTCTTGTGCTGATATTCTCGCAATCGTTGCCAGAGATTCTGTTCTTCTA
GTATATCTTCGCCCACTCTTCATGTTATAAGAAAATCTTACTACTATCTTTTAATGCTTT
GAGCTGATCTCACTTCTACTTAATTTGCAGTCTGGTGGACCGGGCTGGGAAGTCCAGATGGGGAGGAGGGACAGCTTGACTGCTAGCAAGGCAGCAGCGACTAACAACATCCCTGCTCCA
AATTCTAGTGTAGCAACTCTAGTGGCTAATTTTCAGAATGTCGGACTCACACAAAATGATATGGTCGCCCTCTCAG
GTAAAATTTTTGTATCCCAATGCATGAAAGGACACTTCTGCCTA
CTGAACGAAAATCACAGTCTAATTGTAATTTGGCAGGTGCGCACACAATGGGAAAAGCGAGGTGCTCAACTTTTAGCTCTCGGTTCCAGAGCCCTAGTAACTCCGGTGGCCCTGATGTTA
ATATGGACTTCGTTCAGTCGCTGCAGCAACTGTGCTCAGAAACTGCTGACAGCACCACGACAGTAGCACATCTTGACCTGGTGACCCCAGCTACATTTGACAACCAATACTACGTTAATC
TTCTTTCAGGAGAGGGATTGCTTCCATCAGACCAGGTTCTTGTGGTTCAAGATGATCGCACACGTGAGATTGTAGAATCTTATGCGGAGGACCCGTTATTGTTCTTTGAGGACTTCAAGA
ATTCCATGCTCAAAATGGGAGCCTTAGGGCCACTTACTGGTGACAGTGGCGAAATACGTGTGAATTGTAGGGCTGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATGGGCTTAGCCATTTGTTTTATGATGCTTATTAAGCTTGTAATTGCGTTGGCAAAGATACCAACCACCTTGAACACAACATGTGTGGGTGATATTGGTGTCTTATTGCAGTTT
GATGTTTACCAAGAATCCTGCCCAGAGGCAGAACCTATTATACTATCTTGGGTTCAAAGTGCAATCTCCGAGGAACCACGAATGGCAGCTTCCCTGCTTCGTCTTCACTTCCATGATTGC
TTTGTTAAT
GGATGTGATGCTTCAGTGCTGCTAGATGATACTGAGAACTTTGTGGGTGAAAAAACTGCACCACCCAACTTGAATTCACTAAGAGGGTTTGAAGTGATTGATGCCATTAAA
TCTGATCTGGAATCTGTTTGTCCTGAAACAGTTTCTTGTGCTGATATTCTCGCAATCGTTGCCAGAGATTCTGTTCTTCTA
TCTGGTGGACCGGGCTGGGAAGTCCAGATGGGGAGGAGG
GACAGCTTGACTGCTAGCAAGGCAGCAGCGACTAACAACATCCCTGCTCCAAATTCTAGTGTAGCAACTCTAGTGGCTAATTTTCAGAATGTCGGACTCACACAAAATGATATGGTCGCC
CTCTCAG
GTGCGCACACAATGGGAAAAGCGAGGTGCTCAACTTTTAGCTCTCGGTTCCAGAGCCCTAGTAACTCCGGTGGCCCTGATGTTAATATGGACTTCGTTCAGTCGCTGCAGCAA
CTGTGCTCAGAAACTGCTGACAGCACCACGACAGTAGCACATCTTGACCTGGTGACCCCAGCTACATTTGACAACCAATACTACGTTAATCTTCTTTCAGGAGAGGGATTGCTTCCATCA
GACCAGGTTCTTGTGGTTCAAGATGATCGCACACGTGAGATTGTAGAATCTTATGCGGAGGACCCGTTATTGTTCTTTGAGGACTTCAAGAATTCCATGCTCAAAATGGGAGCCTTAGGG
CCACTTACTGGTGACAGTGGCGAAATACGTGTGAATTGTAGGGCTGTCAATTAA

Retrieve as FASTA