Entry information : PtPrx19 (POPTR_0001s18270 / PT01G12790 / Potri.001G182400)
Entry ID 3097
Creation 2010-04-13 (Christophe Dunand)
Last sequence changes 2010-06-22 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information: PtPrx19 (POPTR_0001s18270 / PT01G12790 / Potri.001G182400)
Name (synonym) PtPrx19 (POPTR_0001s18270 / PT01G12790 / Potri.001G182400)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx19
start..stop
S start..stop
PtPrx61 555 0 1..317 1..315
CsPrx02 479 1e-171 4..317 64..379
MePrx84 464 4e-165 1..317 62..421
VvPrx95 445 3e-158 13..316 64..367
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15335286..15335468 183 N° 2 15335768..15335956 189 N° 3 15336031..15336196 166 N° 4 15336741..15336889 149
N° 5 15337268..15337534 267  
join(15335286..15335468,15335768..15335956,15336031..15336196,15336741..15336889 ,15337268..15337534)


exon

Literature and cross-references PtPrx19 (POPTR_0001s18270 / PT01G12790 / Potri.001G182400)
DNA ref. Phytozome 11:   scaffold_1 (15335286..15337534)
Omic ref. ePlant:   Potri.001G182400
Protein sequence: PtPrx19 (POPTR_0001s18270 / PT01G12790 / Potri.001G182400)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317
PWM (Da):   %s   34882.21  
PI (pH):   %s   5.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEDDDGEVSWHSNRSLEYDFYRDSCPEAERIIRRVVHELYEVNSSVAPALLRLVFHDCFIEGCDASILLDAATGIDSEKDSPPNKNLKGFDIIDKIKSEIEMVCPGVVSCADIVALAGREGVVQAGGPFYPLYTGRRDAMHSFRDVATSELPSPNADLSETLASFASRGFDLRETVSLLGGHSIGVIHCKFFQNRLYNFGRTNKPDPSLDTGFLNLLRSRCNDSNSSMEPGMNMAYEGPGVDFGTLYYRSLLQGKGILYSDQQLMAGIDTGIWVRAYASDISLFPRDFALAMMKLSNLRVLTGSKGQVRLHCSKVA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns + 3'). No EST. Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGACGATGATGGAGAAGTATCATGGCATTCAAACCGGTCTCTTGAGTATGATTTCTATCGTGATTCGTGCCCAGAGGCAGAAAGAATCATTCGCAGGGTGGTTCACGAGCTATAT
GAAGTCAACTCCAGTGTAGCTCCTGCTCTTCTAAGGCTCGTGTTTCATGATTGTTTTATTGAG
GTAGATGATTTCAATCTTTCTTTTTGTTGATTCCTAGGGGGTTAGTCACTGCTTAAT
TATTCATCATTTAGTACGACGAAGGTTTTAATTTTTCAGCTTTGGTTGGCAATTCTTTCATGGTATCTTTTGCTTACAAATCTTGATCGAAGACTATTTTGATGTTAAGTTCTTTCTTGT
GGATTTTTGTTTCGGAAGCTTTCAGATTGGAAGTGATTCTGTTTAAGTAAAATTTCGTCTATGTTTCAGTTATCTTCGTTTTTATTACAAGTAGACCTGAGTTCTTTTGTGAATCTTTTC
AGGGGTGTGATGCATCTATTTTGTTGGATGCTGCTACAGGCATTGATTCCGAGAAAGACTCTCCTCCCAATAAAAACTTGAAGGGATTTGATATAATTGACAAAATCAAATCAGAGATTG
AAATGGTGTGCCCAGGAGTTGTTTCTTGTGCTGATATCGTTGCTTTAGCAGGCAGAGAAGGTGTTGTTCAG
GTATAAACATCATTCTGTTTCCTATTTCTCCTTCACTGCTTTCATAATC
TTACTATTGAATTTTTGAATTTCAGGCTGGTGGTCCATTCTATCCACTGTATACTGGCAGGAGGGATGCTATGCATTCTTTCCGAGATGTGGCAACGTCTGAGCTTCCTTCACCCAATGC
TGATCTATCTGAAACCCTAGCATCTTTCGCATCTAGGGGTTTTGATTTAAGAGAAACTGTCAGTCTCCTGG
GTACTAATCTTTCCTTACCATACAAAGGAACACAGAAATCTTTTTATAA
ATCTCTGTTCCTATATTGCTCTTATCAGAATCTATGCTTTCCTCTTCTCTCCTGCTATCAGCTGATGTTTTTCTTATTTCTATGCTTTAATTTTAACATCTGTGAATAAAATGACATTAA
TTCAACTGATGCTTCTGCAAAAGCAGGGCTCAGTTGAGGTGATTTTTCATGCTTTAGTAGAAAACTGGAAGAAAGGCTAGGGCTAAACATTTCAGAAGTATAACTGTGCTGTTCCATCAA
TCTTCCCTATTTATTGGAATGCTTTTTTTGAAATTAATACATGCGAAATCAAAGCCTCCCTCTAAGAACTGGTTGTGGTTTGTGTTTCTATGAATAGCTTTCCGCCTACTTTTCTGCTGG
TGGTGCCGGTAATTTATCATCTCCAACTTCTGCTCCTTGAATAGTTTGGTTATTTCTCACTCTCGCATTCTTGCTGCAAAAATACAACAGCTTAAGATTTGAATGCTTCTAACTGCAACA
TTGCCCTGCTTGTAGGTGGTCACAGCATAGGAGTAATCCACTGCAAATTCTTCCAAAACCGTCTCTACAACTTCGGTAGGACTAATAAGCCCGATCCTTCTCTGGATACAGGGTTTCTTA
ACCTACTGAGATCTAGATGCAATGACAGTAACTCATCGATGGCA
GCATCGCCTTCGCCTTCGCCTTCCTTTAAAGCCACACCACCAGCACCGTCGACTTCCTGTGATGGCACCAACTCAC
CAGCACCGTCGACTTCCTGCGATGGCACCAAGTCACCAGCACCGTCGACTTCCTTTGATGGCACCAAGTCACCAGCACCAGCACCGTCGACTTCCTTTGATGGCACCATGTCACCATCAA
CAGCACCTTCGCTTTCCTGTAGTGGATCACCATCTTCATCGTCCAGGGCAGCAGAAATGAGGGGCTCCCCATCATTATTGTCAGCACCATCACCTTCCTTGAAAGGTTCAATTTCTTCCC
CACCGTCATCATCAACACCTTCATCAGCTTCCTTCGAAGATTCACTGCTTTCCTCACTGGAGGAGCCAGGAATGAATATGGCCTATGAGGGCCCAGGAGTAGATTTTGGCACGTTGTACT
ACCGCAGTCTTTTGCAAGGTAAAGGAATCCTTTATTCCGATCAGCAGCTAATGGCTGGGATAGATACTGGTATTTGGGTACGAGCATATGCTTCAGACATCTCCTTGTTCCCACGAGACT
TTGCCCTAGCAATGATGAAGCTCTCGAATCTCAGAGTCTTGACAGGATCAAAAGGCCAGGTCCGGCTCCATTGTTCAAAGGTGGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGACGATGATGGAGAAGTATCATGGCATTCAAACCGGTCTCTTGAGTATGATTTCTATCGTGATTCGTGCCCAGAGGCAGAAAGAATCATTCGCAGGGTGGTTCACGAGCTATAT
GAAGTCAACTCCAGTGTAGCTCCTGCTCTTCTAAGGCTCGTGTTTCATGATTGTTTTATTGAG
GGGTGTGATGCATCTATTTTGTTGGATGCTGCTACAGGCATTGATTCCGAGAAAGAC
TCTCCTCCCAATAAAAACTTGAAGGGATTTGATATAATTGACAAAATCAAATCAGAGATTGAAATGGTGTGCCCAGGAGTTGTTTCTTGTGCTGATATCGTTGCTTTAGCAGGCAGAGAA
GGTGTTGTTCAG
GCTGGTGGTCCATTCTATCCACTGTATACTGGCAGGAGGGATGCTATGCATTCTTTCCGAGATGTGGCAACGTCTGAGCTTCCTTCACCCAATGCTGATCTATCTGAA
ACCCTAGCATCTTTCGCATCTAGGGGTTTTGATTTAAGAGAAACTGTCAGTCTCCTGG
GTGGTCACAGCATAGGAGTAATCCACTGCAAATTCTTCCAAAACCGTCTCTACAACTTCGGT
AGGACTAATAAGCCCGATCCTTCTCTGGATACAGGGTTTCTTAACCTACTGAGATCTAGATGCAATGACAGTAACTCATCGATGGCA
GAGCCAGGAATGAATATGGCCTATGAGGGCCCA
GGAGTAGATTTTGGCACGTTGTACTACCGCAGTCTTTTGCAAGGTAAAGGAATCCTTTATTCCGATCAGCAGCTAATGGCTGGGATAGATACTGGTATTTGGGTACGAGCATATGCTTCA
GACATCTCCTTGTTCCCACGAGACTTTGCCCTAGCAATGATGAAGCTCTCGAATCTCAGAGTCTTGACAGGATCAAAAGGCCAGGTCCGGCTCCATTGTTCAAAGGTGGCATGA

Retrieve as FASTA