Entry information : PtPrx21 (POPTR_0001s33680 / PT01G21710 / Potri.001G329200)
Entry ID 3099
Creation 2006-06-06 (Claudia Cosio)
Last sequence changes 2006-06-06 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx21 (POPTR_0001s33680 / PT01G21710 / Potri.001G329200)
Name (synonym) PtPrx21 (POPTR_0001s33680 / PT01G21710 / Potri.001G329200)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx21
start..stop
S start..stop
PtPrx82 572 0 1..325 1..323
MePrx64 543 0 3..325 2..324
VvPrx65 539 0 8..325 7..323
CclPrx43 524 0 5..324 5..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 31883317..31883526 210 N° 2 31882663..31882854 192 N° 3 31881978..31882553 576  
complement(join(31881978..31882553,31882663..31882854,31883317..31883526))


exon

Literature and cross-references PtPrx21 (POPTR_0001s33680 / PT01G21710 / Potri.001G329200)
DNA ref. Phytozome 11:   scaffold_1 (31883526..31881978)
Omic ref. ePlant:   Potri.001G329200
Protein sequence: PtPrx21 (POPTR_0001s33680 / PT01G21710 / Potri.001G329200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (302)
PWM (Da):   %s   34833.22 (32169.9)  
PI (pH):   %s   5.14 (5.34) Peptide Signal:   %s   cut: 24 range:24-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MERGRCMLLLMMVLIMDIDRGEGQLVEDFYSLTCPNVEALVKKAVSTKFNQTFTTIPATLRLFFHDCFVTGCDASTMVSSPNGDAEKDAPDNLSLAGDGFDTVVKAKQKVEGACPGVVSCADILAIAARDVVVLAGGPSFNVELGRRDGLVSKASLVKGNLPEPGFNLSQLNAMFARNNLSQIDMIALSGAHTLGFSHCSRFANRLYSFSSSSPVDPSLNQDYAKQLMDGCPRNVDPSIAINMDPVTPQTFDNVYFQNLVNGKGLFTSDEVLFTDPASQPTVKDFANSSSDFNGAFATAMRKLGRVRVKTGSQGSIRTDCTVINS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAGAGGACGTTGCATGCTCTTGCTGATGATGGTTTTGATCATGGACATAGATAGGGGAGAGGGACAGCTAGTAGAAGACTTCTACAGCCTTACTTGTCCTAACGTGGAAGCTCTA
GTGAAGAAGGCAGTTTCCACAAAGTTTAACCAGACATTCACTACAATCCCAGCAACTCTTCGTCTGTTTTTTCATGATTGCTTTGTTACG
GTACGGTATTGGTTCTCTTTTGTTCCATTT
TTGACACTTGTAGTTGATACTCTTCAATGTACATCCGTAGTCATGAATTAATCACCATCATCATCATCCATGGCTGCTACTGATCATAATGCCTTTTGATTGTGTATCCAAGCACTGTAA
ATGATCATCATGGTGAACTAAGTAGCGTAGTTATTGTACATGCAATACGTAATATACATGTAGTCATGATTTTTGTTGATTCCATTGATGAAAATTAAGTTCTAAAACCTCAGGAACCGT
GTCATGAAAAAATGTCGAATTCTTTGTCCCAAGGTATTGTCAATGATACCTCAAACTATAGGAGATTGGATGTTCTAATATTACTATCCCAATTGTTTCTATACGGGAATTGTTTGGCGA
TTTCAACTAGGCTTTCAATACTGCCGACTTCCATACGAGTTTCTCTAGCTGTTTCTACTTGCAATCTAACAGGGTTGTGATGCTTCAACAATGGTTTCTTCACCAAATGGAGACGCAGAG
AAGGATGCTCCAGATAATCTCTCTCTGGCAGGGGATGGATTTGATACAGTAGTGAAGGCAAAGCAAAAAGTCGAAGGAGCTTGCCCCGGAGTAGTCTCCTGTGCAGACATTTTGGCTATA
GCTGCTAGGGATGTCGTAGTCCTG
GTAAGGGAACGCACAAACTAATTATACTTATGTTTTCTAGTATTTCTACAGATTCTACTTGAAAGCAGAAACTAACTTAACCTTTGGGTTTTGTGT
GATCAAAACTCAGGCTGGAGGTCCTTCATTCAATGTAGAATTAGGACGTCGTGATGGCCTGGTTTCAAAAGCATCACTTGTGAAAGGAAACTTGCCAGAACCTGGCTTCAATCTTTCTCA
ACTTAACGCTATGTTTGCGAGAAACAACCTTAGCCAGATTGATATGATTGCACTATCAGGAGCCCACACGCTAGGCTTCTCTCATTGCAGCCGCTTTGCGAATCGGCTCTACTCATTCTC
CTCGTCCTCTCCTGTTGACCCTTCTCTAAATCAAGATTATGCCAAGCAGTTGATGGATGGATGTCCTAGAAATGTAGACCCCAGCATAGCCATTAACATGGACCCTGTAACCCCACAAAC
CTTTGACAATGTGTATTTCCAGAATTTGGTTAATGGTAAGGGATTGTTCACTTCAGATGAGGTGCTGTTTACGGATCCAGCTTCCCAGCCAACTGTCAAAGATTTTGCTAATAGCTCGAG
CGATTTTAATGGAGCTTTTGCCACTGCCATGAGAAAGCTTGGAAGGGTGCGAGTTAAGACAGGTAGCCAAGGAAGTATCAGGACAGACTGTACAGTCATTAATTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAGAGGACGTTGCATGCTCTTGCTGATGATGGTTTTGATCATGGACATAGATAGGGGAGAGGGACAGCTAGTAGAAGACTTCTACAGCCTTACTTGTCCTAACGTGGAAGCTCTA
GTGAAGAAGGCAGTTTCCACAAAGTTTAACCAGACATTCACTACAATCCCAGCAACTCTTCGTCTGTTTTTTCATGATTGCTTTGTTACG
GGTTGTGATGCTTCAACAATGGTTTCTTCA
CCAAATGGAGACGCAGAGAAGGATGCTCCAGATAATCTCTCTCTGGCAGGGGATGGATTTGATACAGTAGTGAAGGCAAAGCAAAAAGTCGAAGGAGCTTGCCCCGGAGTAGTCTCCTGT
GCAGACATTTTGGCTATAGCTGCTAGGGATGTCGTAGTCCTG
GCTGGAGGTCCTTCATTCAATGTAGAATTAGGACGTCGTGATGGCCTGGTTTCAAAAGCATCACTTGTGAAAGGAAAC
TTGCCAGAACCTGGCTTCAATCTTTCTCAACTTAACGCTATGTTTGCGAGAAACAACCTTAGCCAGATTGATATGATTGCACTATCAGGAGCCCACACGCTAGGCTTCTCTCATTGCAGC
CGCTTTGCGAATCGGCTCTACTCATTCTCCTCGTCCTCTCCTGTTGACCCTTCTCTAAATCAAGATTATGCCAAGCAGTTGATGGATGGATGTCCTAGAAATGTAGACCCCAGCATAGCC
ATTAACATGGACCCTGTAACCCCACAAACCTTTGACAATGTGTATTTCCAGAATTTGGTTAATGGTAAGGGATTGTTCACTTCAGATGAGGTGCTGTTTACGGATCCAGCTTCCCAGCCA
ACTGTCAAAGATTTTGCTAATAGCTCGAGCGATTTTAATGGAGCTTTTGCCACTGCCATGAGAAAGCTTGGAAGGGTGCGAGTTAAGACAGGTAGCCAAGGAAGTATCAGGACAGACTGT
ACAGTCATTAATTCATGA

Retrieve as FASTA