Entry information : PtPrx25 (POPTR_0017s06570 / Potri.017G038100)
Entry ID 3103
Creation 2006-06-21 (Claudia Cosio)
Last sequence changes 2006-06-21 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx25 (POPTR_0017s06570 / Potri.017G038100)
Name (synonym) PtPrx25 (POPTR_0017s06570 / Potri.017G038100)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducers Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx25
start..stop
S start..stop
PtrtrPrx05 636 0 2..324 1..323
PtPrx[P]32 553 0 1..324 1..323
PtPrx27 540 0 6..325 6..327
MePrx24 538 0 1..325 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4991992..4992201 210 N° 2 4992288..4992479 192 N° 3 4992573..4992735 163 N° 4 4992820..4993232 413
join(4991992..4992201,4992288..4992479,4992573..4992735,4992820..4993232)


exon

Literature and cross-references PtPrx25 (POPTR_0017s06570 / Potri.017G038100)
Literature DOE joint genome institute.
DNA ref. Phytozome 12:   scaffold_17 (4991992..4993232)
Cluster/Prediction ref. JGI gene:   689736
Omic ref. ePlant:   Potri.017G038100
Protein sequence: PtPrx25 (POPTR_0017s06570 / Potri.017G038100)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (302)
PWM (Da):   %s   35645.13 (33181.9)  
PI (pH):   %s   8.92 (8.93) Peptide Signal:   %s   cut: 24 range:24-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRIGYFGMLIFGLLAFMGSTEAQLKMGFYNTSCPKAEKIVQGFVNQHIHNAPSLAATLIRMHFHDCFVRGCDASVLLNTTSGEQPEKAATPNLTLRGFDFIDRVKRLVEAECPGIVSCADILTLVARDSIVATGGPFWRVPTGRRDGLISRSSEALSNVPSPMINFTTLQTLFANQGLDLKDLVLLSGAHTIGIAHCQSFSNRLYNFTGTGDEDPALDSEYAANLKARKCRSISDNTTIVEMDPGSRKTFDLSYYKLLLKRRGLFQSDAALTTNSNTLSMIRQILQGSIDFRSEFSKSMEKMGRIRVKTGSNGEIRRQCALVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (3 introns) and 2 ESTs (NCBI CV249255, DT496481). Contig also contains PtPrx26.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGGATTGGGTATTTCGGGATGCTAATCTTTGGTCTTTTAGCATTTATGGGCTCAACCGAAGCTCAACTAAAGATGGGTTTTTATAATACAAGCTGCCCGAAAGCTGAGAAGATT
GTGCAAGGCTTTGTAAACCAGCACATCCACAACGCTCCATCATTGGCTGCAACCTTAATCAGAATGCATTTCCATGATTGCTTTGTCAGG
GTATGTATTTGCATATTTACTGCAGAATGT
TGCATGTGTTGATTTTTCAGATTGTGAGATAACACGAGAGGAAACTTTTTTGTCAGGGTTGCGATGCATCTGTGCTGTTGAACACAACTTCCGGCGAACAACCTGAAAAGGCAGCAACTC
CAAATCTTACACTCAGAGGCTTTGACTTCATCGACAGAGTGAAACGCCTAGTTGAAGCTGAATGTCCTGGAATTGTGTCTTGTGCTGATATCCTCACCTTGGTCGCTAGGGACAGTATAG
TAGCCACA
GTATGTAACTCCAAAACAAAACAAAAAAATCTATGCTCTAATACTATTCATTACTCGAGAAACAAAAATAAATTTTCTTTTCAATGTTGACAGGGAGGTCCATTCTGGAGAG
TTCCGACTGGCCGGCGAGACGGTTTGATCTCCAGGTCCTCAGAGGCCTTGTCCAACGTCCCATCTCCCATGATCAACTTCACCACTCTACAAACACTGTTTGCTAACCAAGGTCTTGATT
TGAAAGACCTGGTCTTGCTTTCTG
GTACGTCCCATTTGACATTTTCACTGCGTGACGCATTCTTACAGCGCTGAATCATGGATCATCTAATCAAATTGATTTTCCCAGGTGCTCATACCA
TTGGCATTGCTCATTGTCAATCGTTTTCGAACCGGCTATACAATTTCACTGGGACTGGAGATGAAGACCCAGCTCTAGATAGCGAATATGCTGCGAATTTGAAGGCTAGAAAGTGCAGAA
GTATTAGCGATAACACTACTATAGTTGAGATGGACCCTGGAAGCAGAAAGACATTTGATCTTAGCTACTATAAACTCTTGCTGAAGAGAAGAGGTCTATTTCAATCAGATGCTGCCTTGA
CCACAAACTCTAATACATTGTCTATGATCCGCCAAATACTACAGGGTTCAATAGATTTCCGTTCTGAATTTTCCAAATCCATGGAGAAAATGGGCAGAATTCGTGTTAAAACTGGCTCGA
ATGGCGAGATTAGAAGGCAATGTGCTTTGGTTAATAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGGATTGGGTATTTCGGGATGCTAATCTTTGGTCTTTTAGCATTTATGGGCTCAACCGAAGCTCAACTAAAGATGGGTTTTTATAATACAAGCTGCCCGAAAGCTGAGAAGATT
GTGCAAGGCTTTGTAAACCAGCACATCCACAACGCTCCATCATTGGCTGCAACCTTAATCAGAATGCATTTCCATGATTGCTTTGTCAGG
GGTTGCGATGCATCTGTGCTGTTGAACACA
ACTTCCGGCGAACAACCTGAAAAGGCAGCAACTCCAAATCTTACACTCAGAGGCTTTGACTTCATCGACAGAGTGAAACGCCTAGTTGAAGCTGAATGTCCTGGAATTGTGTCTTGTGCT
GATATCCTCACCTTGGTCGCTAGGGACAGTATAGTAGCCACA
GGAGGTCCATTCTGGAGAGTTCCGACTGGCCGGCGAGACGGTTTGATCTCCAGGTCCTCAGAGGCCTTGTCCAACGTC
CCATCTCCCATGATCAACTTCACCACTCTACAAACACTGTTTGCTAACCAAGGTCTTGATTTGAAAGACCTGGTCTTGCTTTCTG
GTGCTCATACCATTGGCATTGCTCATTGTCAATCG
TTTTCGAACCGGCTATACAATTTCACTGGGACTGGAGATGAAGACCCAGCTCTAGATAGCGAATATGCTGCGAATTTGAAGGCTAGAAAGTGCAGAAGTATTAGCGATAACACTACTATA
GTTGAGATGGACCCTGGAAGCAGAAAGACATTTGATCTTAGCTACTATAAACTCTTGCTGAAGAGAAGAGGTCTATTTCAATCAGATGCTGCCTTGACCACAAACTCTAATACATTGTCT
ATGATCCGCCAAATACTACAGGGTTCAATAGATTTCCGTTCTGAATTTTCCAAATCCATGGAGAAAATGGGCAGAATTCGTGTTAAAACTGGCTCGAATGGCGAGATTAGAAGGCAATGT
GCTTTGGTTAATAGCTAA

Retrieve as FASTA