Entry information : PtPrx27 (POPTR_0007s02580 / Potri.007G122100)
Entry ID 3105
Creation 2006-05-31 (Claudia Cosio)
Last sequence changes 2006-05-31 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx27 (POPTR_0007s02580 / Potri.007G122100)
Name (synonym) PtPrx27 (POPTR_0007s02580 / Potri.007G122100)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue types Leaves
Stems
Inducers Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx27
start..stop
S start..stop
PtPrx26 618 0 1..327 1..328
PtrePrx13 589 0 1..327 1..327
MePrx24 558 0 1..327 1..326
RcPrx71 554 0 7..327 4..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14043521..14043730 210 N° 2 14043232..14043426 195 N° 3 14042973..14043135 163 N° 4 14042461..14042876 416
complement(join(14042461..14042876,14042973..14043135,14043232..14043426,1404352 1..14043730))


exon

Literature and cross-references PtPrx27 (POPTR_0007s02580 / Potri.007G122100)
Literature Ralph,S., et al., Genomics of hybrid poplar (Populus trichocarpax deltoides) interacting with forest tent caterpillars (Malacosoma disstria): normalized and full-length cDNA libraries, expressed sequence tags, and a cDNA microarray for the study of insect-induced defences Mol. Ecol. 15 (5), 1275-1297 (2006).
DNA ref. Phytozome 12:   Chr07 (14043730..14042461)
EST ref. GenBank:   CV240369.1
Omic ref. ePlant:   Potri.007G122100
Protein sequence: PtPrx27 (POPTR_0007s02580 / Potri.007G122100)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (304)
PWM (Da):   %s   35835.86 (33113.6)  
PI (pH):   %s   8.33 (8.22) Peptide Signal:   %s   cut: 24 range:24-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRGFRYFGMMFFCLLVFMGSTEAQLQMGFYSSSCPNAERIAQDYVNRHIHNAPSLAAAIIRMHFHDCFVRGCDASVLLNTTSSNNQTEKVATPNLTLRGFDFIDKVKSLLEAACPAVVSCADIVALVARDAVVATGGPFWRVPTGRRDGTISRSSEALNNIPPPTSNFTNLQRLFANQGLDLKDLVLLSGAHTIGISHCSSFSNRLYNFTGVGDQDPALDSEYAANLKARKCRSLNDNTTIVEMDPGSFRTFDLSYYSLLLKRRGLFQSDSALTTNSATLSFVNQLLQGPLQNFFAEFANSMEKMGRINVKTGTTGEIRKHCAVVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGGGTTTCGTTATTTTGGGATGATGTTCTTTTGTCTTTTGGTATTTATGGGATCAACTGAAGCTCAATTGCAGATGGGTTTTTATTCTAGTAGCTGCCCAAATGCTGAGAGGATT
GCGCAAGACTATGTTAACAGGCATATCCATAATGCTCCATCACTGGCAGCAGCTATCATAAGAATGCATTTCCATGATTGTTTTGTTAGG
GTATGTGTCTTCAATCTTTTTGTGACTGCC
TAGATTTTCACCTCACAAATCTTTGAAACCTTTTGTTTTCACTTTTTTTTTTTTTTTTTATCAGGGTTGTGATGCATCTGTGCTTTTGAACACAACTTCAAGCAATAACCAAACTGAAAA
GGTGGCAACTCCAAATTTGACACTGAGAGGCTTTGATTTCATTGACAAAGTTAAGAGCCTATTAGAAGCGGCCTGCCCTGCTGTAGTCTCCTGTGCTGACATTGTTGCTTTGGTTGCAAG
GGATGCTGTTGTAGCCACT
GTAAGGACTAAAATAAGTCATAACCAAGAATTCAATGCATATGTATATATATCTTCTCATTATTTGGCAAAAACCCTTCTGTTTGAACTTCAACAGGGTGG
TCCATTCTGGAGAGTTCCAACGGGACGAAGAGACGGGACAATTTCAAGATCCTCGGAGGCCTTGAACAATATCCCGCCTCCAACAAGCAACTTCACCAATCTACAGAGACTTTTTGCTAA
CCAAGGACTGGACTTGAAAGACTTAGTCTTGCTATCAG
GTACTACACTTAAAGAAAATGCCACTCCCTAGCTCTGCATATGATTTGAAACGTTGCTTGCCGCAATGTTTATCATGATCCT
GCTGAATATTTCAGGTGCTCACACAATTGGGATATCACATTGTTCATCATTTTCAAACCGCCTTTACAATTTCACTGGAGTAGGTGATCAGGACCCAGCTCTAGATAGCGAATACGCTGC
CAATCTCAAGGCAAGGAAGTGCAGAAGTCTTAATGACAATACCACTATAGTAGAAATGGACCCTGGAAGTTTCAGGACATTTGATCTTAGCTACTACAGTCTTTTACTCAAAAGACGGGG
TCTGTTCCAATCTGATTCTGCCTTAACCACAAACTCCGCTACATTGTCTTTCGTCAACCAGCTACTCCAAGGTCCACTTCAGAATTTCTTTGCGGAATTCGCAAATTCCATGGAGAAAAT
GGGCAGAATCAATGTTAAGACCGGCACAACTGGAGAAATTAGAAAGCACTGTGCAGTTGTGAATAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGGGTTTCGTTATTTTGGGATGATGTTCTTTTGTCTTTTGGTATTTATGGGATCAACTGAAGCTCAATTGCAGATGGGTTTTTATTCTAGTAGCTGCCCAAATGCTGAGAGGATT
GCGCAAGACTATGTTAACAGGCATATCCATAATGCTCCATCACTGGCAGCAGCTATCATAAGAATGCATTTCCATGATTGTTTTGTTAGG
GGTTGTGATGCATCTGTGCTTTTGAACACA
ACTTCAAGCAATAACCAAACTGAAAAGGTGGCAACTCCAAATTTGACACTGAGAGGCTTTGATTTCATTGACAAAGTTAAGAGCCTATTAGAAGCGGCCTGCCCTGCTGTAGTCTCCTGT
GCTGACATTGTTGCTTTGGTTGCAAGGGATGCTGTTGTAGCCACT
GGTGGTCCATTCTGGAGAGTTCCAACGGGACGAAGAGACGGGACAATTTCAAGATCCTCGGAGGCCTTGAACAAT
ATCCCGCCTCCAACAAGCAACTTCACCAATCTACAGAGACTTTTTGCTAACCAAGGACTGGACTTGAAAGACTTAGTCTTGCTATCAG
GTGCTCACACAATTGGGATATCACATTGTTCA
TCATTTTCAAACCGCCTTTACAATTTCACTGGAGTAGGTGATCAGGACCCAGCTCTAGATAGCGAATACGCTGCCAATCTCAAGGCAAGGAAGTGCAGAAGTCTTAATGACAATACCACT
ATAGTAGAAATGGACCCTGGAAGTTTCAGGACATTTGATCTTAGCTACTACAGTCTTTTACTCAAAAGACGGGGTCTGTTCCAATCTGATTCTGCCTTAACCACAAACTCCGCTACATTG
TCTTTCGTCAACCAGCTACTCCAAGGTCCACTTCAGAATTTCTTTGCGGAATTCGCAAATTCCATGGAGAAAATGGGCAGAATCAATGTTAAGACCGGCACAACTGGAGAAATTAGAAAG
CACTGTGCAGTTGTGAATAGCTAA

Retrieve as FASTA