Entry information : PtPrx28 (POPTR_1693s00200)
Entry ID 3106
Creation 2006-06-14 (Claudia Cosio)
Last sequence changes 2006-06-14 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx28 (POPTR_1693s00200)
Name (synonym) PtPrx28 (POPTR_1693s00200)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx28
start..stop
S start..stop
PtPrx29 654 0 1..327 1..327
PtPrx77 635 0 1..327 1..327
RcPrx10 528 0 1..327 1..327
RcPrx62 520 0 1..327 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1716..1937 222 N° 2 2104..2292 189 N° 3 2373..2538 166 N° 4 2615..3021 407
join(1716..1937,2104..2292,2373..2538,2615..3021)


exon

Literature and cross-references PtPrx28 (POPTR_1693s00200)
Literature DOE joint genome institute.
DNA ref. Phytozome 12:   scaffold_1693 (1716..3021)
Protein sequence: PtPrx28 (POPTR_1693s00200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (301)
PWM (Da):   %s   35563.22 (32739.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.62 (8.55) Peptide Signal:   %s   cut: 27 range:27-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIQKLFAVCFLQLVFAFLLAGLTNAGGLQLGFYQRACPDAELIVHQTLYRYVSRDRTLAAPLLRMHFHDCFIRGCEGSVLLSSTKNNQAEKDAIPNKTLRGFNVIDAVKSALEKKCPGVVSCADILALVARDAVLMIGGPRWDVPTGRRDGRVSIANEALFNLPSPFANITVLKQQFAATGLSVKDLAVLSGGHTIGIGHCTIISNRLYNFTGKGDTDPSLDPRYAAQLKNKCKPGNSNTVVEMDPGSFKSFDEDYYNIVAKRRGLFRSDAALLDDAETRGYVKFQSMTQGSTFAQDFAESMVKMGYIGVLTGEQGEIRKHCAVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). ESTs from other populus sp and hybrids.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATTCAAAAGCTTTTCGCGGTCTGCTTTCTTCAACTCGTTTTCGCCTTTTTGCTTGCAGGCCTCACTAATGCAGGGGGGCTGCAACTCGGATTCTACCAGAGAGCATGTCCTGAT
GCAGAGCTTATAGTCCATCAAACTCTTTATCGTTACGTCTCTAGGGACCGAACCCTTGCTGCTCCTCTGCTACGAATGCATTTCCATGATTGCTTTATCAGG
GTAAGCTTTTAAGCTGAA
GTACTAGTATGCAATTTACACAGTATGTATCTGATATCATCATCATCATCTCAATGTTACCTTGCCACAAAAGCACTTGGAAATCAAGCGTTTTCATCTTGTTTAGGAAACCACACAATT
TCATATCCTAACAAGTTATGCTTTCCAGGGATGTGAGGGTTCTGTGCTCCTAAGTTCTACAAAGAATAATCAAGCTGAGAAAGACGCCATCCCAAATAAAACCTTAAGAGGGTTCAATGT
CATTGATGCTGTAAAATCAGCACTAGAAAAGAAGTGTCCTGGTGTGGTTTCCTGTGCCGATATCTTGGCCTTGGTTGCTCGTGACGCGGTTCTAATG
GTATCAAATTTACCAACACAATT
TATCACCACTGATTAACTGGATCATTATGCCGATGCTTAACCAGTTTTTCCATTCAGATTGGCGGACCACGTTGGGATGTTCCCACAGGACGCAGAGACGGAAGGGTGTCGATTGCCAAC
GAGGCTTTATTCAATTTACCATCTCCTTTTGCCAACATAACTGTCCTGAAACAACAATTTGCTGCAACGGGTTTAAGTGTAAAGGACCTTGCAGTTTTATCAG
GTAGTTTTCGTAACAAA
AAAAGCTATCTATTAAGCAAAATATCAGCGTATTTACTTGGAATATGTTTTGGTGACAGGAGGACACACCATAGGAATTGGACACTGTACCATAATCTCGAACAGGTTGTACAATTTCAC
AGGCAAGGGAGATACTGACCCTTCATTGGACCCAAGATACGCTGCTCAACTGAAGAATAAATGTAAGCCTGGAAACTCCAACACAGTCGTTGAGATGGACCCTGGTAGCTTCAAGTCTTT
CGACGAAGATTACTACAACATTGTAGCTAAAAGAAGAGGGCTATTCCGATCTGATGCAGCTCTTCTTGACGATGCTGAAACAAGAGGCTATGTCAAATTTCAGTCAATGACACAGGGATC
CACTTTTGCACAAGATTTTGCTGAATCCATGGTGAAAATGGGTTACATTGGAGTCCTGACCGGCGAACAAGGCGAAATCAGGAAACATTGTGCTGTTGTGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATTCAAAAGCTTTTCGCGGTCTGCTTTCTTCAACTCGTTTTCGCCTTTTTGCTTGCAGGCCTCACTAATGCAGGGGGGCTGCAACTCGGATTCTACCAGAGAGCATGTCCTGAT
GCAGAGCTTATAGTCCATCAAACTCTTTATCGTTACGTCTCTAGGGACCGAACCCTTGCTGCTCCTCTGCTACGAATGCATTTCCATGATTGCTTTATCAGG
GGATGTGAGGGTTCTGTG
CTCCTAAGTTCTACAAAGAATAATCAAGCTGAGAAAGACGCCATCCCAAATAAAACCTTAAGAGGGTTCAATGTCATTGATGCTGTAAAATCAGCACTAGAAAAGAAGTGTCCTGGTGTG
GTTTCCTGTGCCGATATCTTGGCCTTGGTTGCTCGTGACGCGGTTCTAATG
ATTGGCGGACCACGTTGGGATGTTCCCACAGGACGCAGAGACGGAAGGGTGTCGATTGCCAACGAGGCT
TTATTCAATTTACCATCTCCTTTTGCCAACATAACTGTCCTGAAACAACAATTTGCTGCAACGGGTTTAAGTGTAAAGGACCTTGCAGTTTTATCAG
GAGGACACACCATAGGAATTGGA
CACTGTACCATAATCTCGAACAGGTTGTACAATTTCACAGGCAAGGGAGATACTGACCCTTCATTGGACCCAAGATACGCTGCTCAACTGAAGAATAAATGTAAGCCTGGAAACTCCAAC
ACAGTCGTTGAGATGGACCCTGGTAGCTTCAAGTCTTTCGACGAAGATTACTACAACATTGTAGCTAAAAGAAGAGGGCTATTCCGATCTGATGCAGCTCTTCTTGACGATGCTGAAACA
AGAGGCTATGTCAAATTTCAGTCAATGACACAGGGATCCACTTTTGCACAAGATTTTGCTGAATCCATGGTGAAAATGGGTTACATTGGAGTCCTGACCGGCGAACAAGGCGAAATCAGG
AAACATTGTGCTGTTGTGAATTAA

Retrieve as FASTA