Entry information : PtPrx[P]32
Entry ID 3110
Creation 2008-04-25 (Christophe Dunand)
Last sequence changes 2010-08-02 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2010-08-02 (Christophe Dunand)
Peroxidase information: PtPrx[P]32
Name PtPrx[P]32
Class Class III peroxidase     [Orthogroup: Prx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx[P]32
start..stop
S start..stop
PtPrx25 553 0 1..323 1..324
PtrtrPrx05 543 0 2..323 1..323
MePrx24 499 3e-180 1..323 1..325
RcPrx70 493 1e-177 2..323 3..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1522028..1522416 389 N° 2 1522550..1522741 192 N° 3 1522831..1522988 158 N° 4 1523077..1523488 412
join(1522028..1522416,1522550..1522741,1522831..1522988,1523077..1523488)


exon

Literature and cross-references PtPrx[P]32
DNA ref. Phytozome 12:   scaffold_7 (1522028..1523488)
Protein sequence: PtPrx[P]32
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (299)
PWM (Da):   %s   34855.56 (32596.3)  
PI (pH):   %s   6.98 (6.98) Peptide Signal:   %s   cut: 24 range:24-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKIGCTGILIIGLLAFLGSTEA*LKMGFYATSCPKAEKTVQDFVNQHIHNAPFLAAAFIRMHFHDCLVRGCDASVLLNTTSGEQPEKAASPNLTLRGFDFIDRVKSLVKAECPGIVSCADILTLVARDSVVAIGGPFWGVPTGRRDLISKSSEVISNIPHSLWQLHHSTTLFSNQGLDLKDLVLLSGAHTIGIAHCSSFSNRLYNFTGTGDQDPALDSEYAANLKANKCKNINDNTTKVEMDPGSRNTFDLSYYALVLKRRGLFESDADLTTNSDALSMINQLLQGSLDFYSEFAKSMEKMGMINVKTGSNGEIRKQCALVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns). Stop in the PS and frame shift in exon 3. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAAGATCGGTTGTACTGGGATACTAATCATTGGTCTTTTAGCATTTTTGGGCTCAACTGAAGCTTAACTAAAGATGGGTTTCTATGCTACGAGCTGCCCAAAAGCTGAGAAGACT
GTGCAGGACTTTGTTAACCAGCACATCCACAATGCTCCATTCTTGTTAAAACAATTCAAATTAACATAAAAGAAATACGAAATAGAGAAAGATTTTCATTAATTATTTTATTCTGAAATG
TTGCTTTAACTGAATACAAAGAGATTATACATAGACTAAACTGAAAATATTATTCTACTATTAATAAATAAAACAAGATAAATATACATATATTTCTTAACAGGCTGCAGCCTTTATCAG
AATGCATTTTCATGATTGCCTTGTCAGGG
TTTGTGCTTGCATGTAACTGCATTTTTAACTCTCTGCTATCTGCCTTTCTTCTCATGATTTTACTGCACAATGTTGAATATGTTGATTTTT
CAGATTGTGAAATAACAAGAGAGGAAAAATGCTTGTGTCAGGGTTGTGATGCATCTGTGCTGTTGAACACAACTTCCGGCGAACAGCCTGAAAAGGCAGCCAGTCCAAATCTAACACTTA
GAGGCTTTGACTTCATTGACAGAGTTAAAAGCCTAGTTAAAGCCGAATGTCCTGGAATTGTGTCTTGCGCAGATATTCTTACCTTGGTCGCAAGGGACAGTGTAGTAGCCATAG
TATGTA
ATTCCAACACAAAAAACCCTTCACTAGATCTAATACTACTGATTGTTAAAAACACAAGGACAGGGAGGTCCATTCTGGGGAGTTCCAACTGGCCGGCGAGACGGGTTTGATCTCAAAGTC
CTCAGAGGTCATTTCCAACATCCCACACTCCCTTTGGCAACTTCACCACTCTACAACACTCTTTTCTAACCAAGGTCTTGATTTGAAAGACCTGGTCTTGCTTTCTGGTATGTCCCATCT
T
AACATTTTCATTACGTGAGATTCTTACAGCCTTAAATCATAGATTTCTCCAGGTGCTCATACAATTGGCATTGCTCATTGTTCATCGTTTTCGAACCGGCTATACAATTTTACTGGGAC
TGGAGACCAAGATCCAGCACTAGATAGTGAATACGCAGCAAATTTAAAGGCAAACAAGTGCAAGAACATTAATGATAACACTACTAAAGTTGAGATGGACCCTGGAAGCAGAAACACATT
TGATCTTAGCTACTATGCACTTGTACTTAAAAGAAGAGGTCTCTTTGAATCAGATGCTGACTTGACCACAAATTCCGATGCATTGTCTATGATCAACCAACTACTCCAGGGCTCACTTGA
TTTCTATTCTGAATTTGCCAAGTCCATGGAGAAAATGGGTATGATTAATGTTAAAACCGGCTCCAACGGTGAGATTAGGAAGCAATGTGCTTTGGTTAATAGG

Retrieve as FASTA