Entry information : PtPrx37 (POPTR_0007s01580 / Potri.007G132800)
Entry ID 3115
Creation 2008-04-25 (Christophe Dunand)
Last sequence changes 2010-06-18 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx37 (POPTR_0007s01580 / Potri.007G132800)
Name (synonym) PtPrx37 (POPTR_0007s01580 / Potri.007G132800)
Class Class III peroxidase    [Orthogroup: Prx031]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx37
start..stop
S start..stop
PtremPrx05 594 0 8..301 1..294
JcPrx01 563 0 8..336 4..332
RcPrx14 540 0 1..336 1..337
MePrx124 526 0 1..336 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14672684..14672932 249 N° 2 14673074..14673253 180 N° 3 14673383..14673542 160 N° 4 14673806..14674242 437
join(14672684..14672932,14673074..14673253,14673383..14673542,14673806..14674242 )


exon

Literature and cross-references PtPrx37 (POPTR_0007s01580 / Potri.007G132800)
DNA ref. Phytozome 12:   Chr07 (14672684..14674242)
Omic ref. ePlant:   Potri.007G132800
Protein sequence: PtPrx37 (POPTR_0007s01580 / Potri.007G132800)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (315)
PWM (Da):   %s   37821.23 (34974.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.84 (8.85) Peptide Signal:   %s   cut: 27 range:27-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRRGQKCVFFPLLAIALCLCIANVDAGITLQPPVKLKWHYYRQHTTCTYAEEFVRHQVELFWKADRSITAKLLRLLYSDCFVTGCDASILLDGPDSEKTAPQNWGLGGFVAIDKIKEVLEIRCPGVVSCADILNLATRDAVHLAGGPAYPVFTGRRDGVSSKASTVDLPSPSISGGEALAYFKSRGLDVLDLGTLLGAHSMGRTHCRYILDRLYNFNNTGRPDPSMNKAFADQMRKQCPQRTKKGQSDPLVFLNPESSSKYTFTESFYKRVLSYQSVLGVDQQLLFSNDTLQITQEFAGGFEYLRRSLALSMSRMGNINVLTGNAGEIRRNCRYINDGKPQ

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (chromo 7, 3 introns). No EST. No prediction from phytozome. Containing motif 'YSDC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGAGGTCAGAAGTGCGTGTTTTTCCCGCTACTGGCTATTGCATTATGCTTGTGTATAGCAAATGTGGATGCCGGGATAACACTGCAACCACCGGTAAAGTTGAAATGGCATTAC
TACCGGCAGCATACTACATGCACCTATGCAGAGGAGTTTGTTAGGCACCAGGTAGAGTTATTTTGGAAGGCAGATAGAAGCATTACTGCCAAGCTTCTTCGGTTGCTCTACTCGGATTGC
TTTGTGACT
GTATGTCTCTCTCAACCATTCAATCTTATTCTACGTTTCTTCCTTCCACTCTTATTCGGTGTCTTTAGTCTTTACCAGGCAAGGCAAGCCATTTCAATTGCTGAGAAATAA
TGAGTACTTGTTTCTTCTTATCTAACTTAGGGCTGTGATGCATCGATTCTTCTTGACGGACCAGACTCAGAGAAGACAGCTCCACAAAACTGGGGTCTCGGAGGATTTGTGGCCATTGAC
AAAATAAAAGAAGTTCTTGAGATACGGTGTCCTGGTGTTGTCTCTTGTGCTGATATTCTCAACCTGGCTACCAGGGATGCTGTTCATTTG
GTAACATCCTACACACCCTGCATATTGACC
TAGACACAGTAGCGCAATAGCCTATTTTGCCTAAATTCAAATAAAAACTTCATGGACACTTAAATTTTGTTACTAATCTATAACCCATCTACCCAACAGGCAGGCGGACCAGCTTATCCC
GTGTTCACAGGAAGAAGGGATGGAGTGTCATCAAAAGCATCAACGGTGGATCTCCCATCACCATCCATCTCAGGGGGAGAAGCATTGGCATATTTCAAGTCTAGAGGCCTGGATGTGTTG
GACCTGGGAACACTATTAG
GTAAGCACTGAAAGTATTACAACTCGAGAAATCAGTAATATTTGACGAATCTATAAATGTGTTCCTTAGTTCGAAGGTTTTTCTATAATCTTAATGTTAAA
ATCTTGTCCCACATAACTAAGTAACTGCCGTGATTCTAAAGAAGTTCAAGTTGAAAAGAAAAAAAGTCAGTCAAATGCAAATGTGCCAAGTCAAGAGGTACTTCCACATATTGCCCCAAA
TTTAAGTTCATATTCTGGCAATTCTCATATGACTCTTATCAGGGGCACACTCAATGGGGAGAACACATTGTCGCTACATTTTGGACCGACTGTACAATTTCAACAATACCGGAAGGCCAG
ACCCAAGCATGAACAAAGCATTTGCAGATCAAATGAGAAAGCAATGTCCCCAAAGAACCAAAAAGGGCCAATCTGACCCACTGGTGTTTCTAAACCCAGAATCTAGCTCTAAATACACCT
TTACAGAATCCTTCTACAAGAGGGTTCTCTCCTACCAGTCTGTCCTAGGAGTTGATCAGCAACTACTTTTCAGCAATGACACACTACAGATAACACAAGAATTTGCTGGTGGTTTTGAGT
ACTTAAGAAGGTCACTTGCTCTATCAATGAGTAGGATGGGAAACATCAATGTGCTAACGGGAAATGCAGGAGAGATACGCCGAAATTGCCGATACATAAATGATGGCAAACCCCAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGAGAGGTCAGAAGTGCGTGTTTTTCCCGCTACTGGCTATTGCATTATGCTTGTGTATAGCAAATGTGGATGCCGGGATAACACTGCAACCACCGGTAAAGTTGAAATGGCATTAC
TACCGGCAGCATACTACATGCACCTATGCAGAGGAGTTTGTTAGGCACCAGGTAGAGTTATTTTGGAAGGCAGATAGAAGCATTACTGCCAAGCTTCTTCGGTTGCTCTACTCGGATTGC
TTTGTGACT
GGCTGTGATGCATCGATTCTTCTTGACGGACCAGACTCAGAGAAGACAGCTCCACAAAACTGGGGTCTCGGAGGATTTGTGGCCATTGACAAAATAAAAGAAGTTCTTGAG
ATACGGTGTCCTGGTGTTGTCTCTTGTGCTGATATTCTCAACCTGGCTACCAGGGATGCTGTTCATTTG
GCAGGCGGACCAGCTTATCCCGTGTTCACAGGAAGAAGGGATGGAGTGTCA
TCAAAAGCATCAACGGTGGATCTCCCATCACCATCCATCTCAGGGGGAGAAGCATTGGCATATTTCAAGTCTAGAGGCCTGGATGTGTTGGACCTGGGAACACTATTAG
GGGCACACTCA
ATGGGGAGAACACATTGTCGCTACATTTTGGACCGACTGTACAATTTCAACAATACCGGAAGGCCAGACCCAAGCATGAACAAAGCATTTGCAGATCAAATGAGAAAGCAATGTCCCCAA
AGAACCAAAAAGGGCCAATCTGACCCACTGGTGTTTCTAAACCCAGAATCTAGCTCTAAATACACCTTTACAGAATCCTTCTACAAGAGGGTTCTCTCCTACCAGTCTGTCCTAGGAGTT
GATCAGCAACTACTTTTCAGCAATGACACACTACAGATAACACAAGAATTTGCTGGTGGTTTTGAGTACTTAAGAAGGTCACTTGCTCTATCAATGAGTAGGATGGGAAACATCAATGTG
CTAACGGGAAATGCAGGAGAGATACGCCGAAATTGCCGATACATAAATGATGGCAAACCCCAATAA

Retrieve as FASTA