Entry information : PtPrx41(POPTR_0013s15250 / PT13G11010 / Potri.013G156500)
Entry ID 3119
Creation 2006-05-22 (Claudia Cosio)
Last sequence changes 2006-05-22 (Catherine )
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-04-22 (Catherine )
Peroxidase information: PtPrx41(POPTR_0013s15250 / PT13G11010 / Potri.013G156500)
Name PtPrx41(POPTR_0013s15250 / PT13G11010 / Potri.013G156500)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue types Female inflorescence
Flowers
Leaves
Stems
Inducers Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx41
start..stop
S start..stop
PbPrx09 653 0 1..325 1..325
MePrx83 527 0 11..325 2..316
CclPrx07 511 0 6..325 4..323
CsPrx15 511 0 6..325 4..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15923257..15923481 225 N° 2 15922301..15922492 192 N° 3 15922051..15922219 169 N° 4 15921082..15921473 392
complement(join(15921082..15921473,15922051..15922219,15922301..15922492,1592325 7..15923481))


exon

Literature and cross-references PtPrx41(POPTR_0013s15250 / PT13G11010 / Potri.013G156500)
Literature Ralph,S., Oddy,C., Cooper,D., Yueh,H., Jancsik,S., Kolosova,N., Philippe,R.N., Aeschliman,D., White,R., Huber,D., Ritland,C.E., Benoit,F., Rigby,T., Nantel,A., Butterfield,Y.S.N., Kirkpatrick,R., Chun,E., Liu,J., Palmquist,D., Wynhoven,B., Stott,J., Yang,G.,Barber,S., Holt,R., Siddiqui,A., Jones,S., Marra,M., Ellis,B.E., Douglas,C.J., Ritland,K. and Bohlmann,J. Genomics of hybrid poplar (Populus trichocarpax deltoides) interacting with forest tent caterpillars (Malacosoma disstria): normalized and full-length cDNA libraries, expressed sequence tags, and a cDNA microarray for the study of insect-induced defences Mol. Ecol. 15 (5), 1275-1297 (2006)
DNA ref. Phytozome 12:   Chr13 (15923481..15921082)
EST ref. GenBank:   73875458
Omic ref. ePlant:   Potri.013G156500
Protein sequence: PtPrx41(POPTR_0013s15250 / PT13G11010 / Potri.013G156500)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (297)
PWM (Da):   %s   34944.75 (31894.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   10.07 (10.02) Peptide Signal:   %s   cut: 29 range:29-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARPSSFSSYMAIFTLAFLVIFTSHSSAQLSTNFYSKSCPKVFGAVKSVVQSAVSKERRMGASLVRLFFHDCFVRGCDGSILLEDTSSFTGEQTAGPNNNSVRGFNVVAKIKSQVEKVCPGIVSCADIVAIAARDSTVILGGPFWNVKLGRRDSKTASLSAANSGVIPPPTSTLSNLINRFNSKGLSVKDMVALSGSHTIGQARCTSFRARIYNETNIDSSFATTRQKNCPFPGPKGDNKLAPLDVQTPTSFDNKYYKNLISQKGLLHSDQVLFNGGSTDSLVRTYSSNPKTFSSDFVTAMIKMGDIDPLTGSQGEIRKICSKRN

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (3 introns) and 8 ESTs (NCBI DT478196, DT492311, DT483262, DT487692, DT487423, DT482024, DN501267, BU882579)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGACCTAGCTCCTTTTCTTCTTATATGGCCATCTTTACATTAGCTTTCCTTGTGATCTTCACAAGTCACTCCTCAGCTCAACTCTCAACAAATTTTTACTCCAAGAGTTGTCCA
AAAGTCTTTGGTGCAGTGAAATCTGTTGTTCAATCTGCAGTGTCGAAAGAGCGCCGGATGGGTGCTTCTCTTGTTCGCTTGTTCTTTCATGATTGTTTTGTCAGA
GTATTTCTCTTTTTC
TCTCTACTTAACTGAACTCTTCCCTTACTTTGCTAGGTGGTTTGTTACATGGCGTTAAATCCTTTGATTTTTTTTTTTTATATCAAAACATCAAAGTCATAAAAATAAATATTAATTTAA
TGTTTTTTCAAAATGAAATTACTTTAAAAAGCAACAAAAAGTAAAAACTATCACTCCTGGGTAAATTTTTTTTATCGGAATGGATTATTATATTGGCGCGCTAATAATGTGACAAACACA
ATTAGATCTTGAAAGGGACTGCTGTGCATAAAATATGTGTTTCTTATCATGAACAGCAAAAGTAAGAGAATTCTATGGTAAAAAACAAACTTAGTACAATTATATAGATATGCTGAAATC
ATGGTGATCGACACTTCTTCACTTTTCCTTCCTTGTCTCATTTGTTACATCAATTCACTCTAACTCAGCTCCCTAATTCCTGAAGAGACTAGCATTAACTTTTGCCGTCCAAAATCATAC
ATGTTAATTTGTATGGATTTCTTTCTTCCATTACTTCGAATTATAATGACTTCTGTAAAATTTGATTTATTTTCTTTAACTGAATCACATAAACTTTATATTTCTAGTGAAAAGAGTTAA
ATATATAAAAAGATTTTTATGATGATCAGAGAATAAGTATGAGTAATATATGTGTTAGGAACACCAAAAAAAACCTCTTTTTTTTGTGAGTTAATTTATTTACTTGTAAGAATTAACATT
CTGGGAAAATTTATTTTCTTTTCTGACAGGGTTGTGATGGGTCAATACTTCTGGAGGATACTTCCTCTTTCACCGGAGAACAAACTGCTGGTCCAAATAATAATTCTGTGAGGGGATTTA
ATGTTGTTGCCAAGATTAAGTCTCAGGTGGAGAAAGTCTGCCCAGGCATAGTTTCATGTGCTGATATCGTAGCCATTGCTGCTCGTGACTCTACTGTGATT
GTAAGTAATCGAAAGTTCT
TTCCATTTCCTCTAAGTTTTTTTGTTCAATGTTTCGTTGAGACTGTTGTTAATTTCTTGCAGCTTGGAGGTCCATTTTGGAATGTAAAACTTGGAAGAAGGGATTCAAAGACAGCTAGCC
TTTCTGCTGCCAACAGTGGGGTCATCCCTCCTCCAACTTCTACGCTTAGCAACCTCATCAATCGGTTTAATAGTAAAGGCCTCTCAGTCAAGGACATGGTTGCCTTATCCG
GTACGTGTA
TATATATATATATATATACAATTGAGTAATATGCTAATTATGCAGAATAGTCTTCCAAAAATCAGTTTTCAAAATATCTCATTCATCGGATCGATGAATGAATCCACTATAATACTAATG
GATCCTATAAAATTCAATTCAGTGGATGAGATTTTTTCCACAAGAAATATCTTCAATATGATTACTATAATTTAGGTACGTTTGATTGCGATCTTATGGTTGTTTTTCCTTGCCATTTGT
TGGCTTTAATTTGTGCTGACTAGAGACGAAAAAGAAAGAAAGAAAAAGTACAAGGACAAAAAATAGTTTGATTAAAGAAATAAAAGATAAAAATATAGGATAAATTTGTTTCTAAAGATA
ATTTTGAAGTGAATTTTTGTATATTTTAAATAGAAAATATAAGGTGACATGATACTTTTATCCTCATTGTTTCTATTTTTTTTTCCTGTTTTGAAACAATAACTAATTAAATGCTAAGTA
AATATTGTTACCATTGTTCAATATCTATACTACAATCTTTTTTATGACATAAATGCTTCATTCTAAAGCTGTTCAACATTGGTACCAGGATCCCACACAATCGGGCAAGCAAGGTGTACA
AGCTTTAGAGCTCGCATATACAATGAGACCAACATAGATAGTTCATTTGCTACCACTAGGCAAAAGAACTGTCCATTTCCTGGACCGAAAGGAGATAACAAGTTAGCACCTTTGGATGTC
CAAACTCCTACATCATTTGACAACAAATATTACAAGAATCTCATCAGCCAAAAGGGTCTCCTTCACTCTGATCAAGTTCTGTTTAATGGTGGATCAACAGATTCTTTGGTTAGAACTTAC
AGCAGCAATCCTAAAACCTTCAGTTCTGACTTCGTCACAGCCATGATTAAGATGGGAGATATTGATCCCCTTACTGGATCCCAGGGTGAAATTAGGAAGATATGTAGCAAGCGAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGACCTAGCTCCTTTTCTTCTTATATGGCCATCTTTACATTAGCTTTCCTTGTGATCTTCACAAGTCACTCCTCAGCTCAACTCTCAACAAATTTTTACTCCAAGAGTTGTCCA
AAAGTCTTTGGTGCAGTGAAATCTGTTGTTCAATCTGCAGTGTCGAAAGAGCGCCGGATGGGTGCTTCTCTTGTTCGCTTGTTCTTTCATGATTGTTTTGTCAGA
GGTTGTGATGGGTCA
ATACTTCTGGAGGATACTTCCTCTTTCACCGGAGAACAAACTGCTGGTCCAAATAATAATTCTGTGAGGGGATTTAATGTTGTTGCCAAGATTAAGTCTCAGGTGGAGAAAGTCTGCCCA
GGCATAGTTTCATGTGCTGATATCGTAGCCATTGCTGCTCGTGACTCTACTGTGATT
CTTGGAGGTCCATTTTGGAATGTAAAACTTGGAAGAAGGGATTCAAAGACAGCTAGCCTTTCT
GCTGCCAACAGTGGGGTCATCCCTCCTCCAACTTCTACGCTTAGCAACCTCATCAATCGGTTTAATAGTAAAGGCCTCTCAGTCAAGGACATGGTTGCCTTATCCG
GATCCCACACAATC
GGGCAAGCAAGGTGTACAAGCTTTAGAGCTCGCATATACAATGAGACCAACATAGATAGTTCATTTGCTACCACTAGGCAAAAGAACTGTCCATTTCCTGGACCGAAAGGAGATAACAAG
TTAGCACCTTTGGATGTCCAAACTCCTACATCATTTGACAACAAATATTACAAGAATCTCATCAGCCAAAAGGGTCTCCTTCACTCTGATCAAGTTCTGTTTAATGGTGGATCAACAGAT
TCTTTGGTTAGAACTTACAGCAGCAATCCTAAAACCTTCAGTTCTGACTTCGTCACAGCCATGATTAAGATGGGAGATATTGATCCCCTTACTGGATCCCAGGGTGAAATTAGGAAGATA
TGTAGCAAGCGAAATTAA

Retrieve as FASTA