Entry information : PtPrx44 (POPTR_0005s11070 / Potri.005G108900)
Entry ID 3134
Creation 2006-05-31 (Claudia Cosio)
Last sequence changes 2010-06-17 (Marie Brette (Scipio))
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx44 (POPTR_0005s11070 / Potri.005G108900)
Name (synonym) PtPrx44 (POPTR_0005s11070 / Potri.005G108900)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue types Flower buds
Leaves
Stems
Inducers Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Phoma infection
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx44
start..stop
S start..stop
MePrx02 553 0 1..317 1..316
GhPrx23 533 0 1..317 1..317
RcPrx13 531 0 19..317 19..317
EglPrx158 526 0 1..317 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8026365..8026571 207 N° 2 8026657..8026845 189 N° 3 8026993..8027155 163 N° 4 8027244..8027638 395
join(8026365..8026571,8026657..8026845,8026993..8027155,8027244..8027638)


exon

Literature and cross-references PtPrx44 (POPTR_0005s11070 / Potri.005G108900)
Literature Unneberg,P., Bhalerao,R.R., Jansson,S. and Sterky,F. The poplar tree transcriptome: Analysis of expressed sequence tags from multiple libraries Unpublished (2002).
DNA ref. Phytozome 12:   scaffold_5 (8026365..8027638)
mRNA ref. JGI transcript:   741255
Omic ref. ePlant:   Potri.005G108900
Protein sequence: PtPrx44 (POPTR_0005s11070 / Potri.005G108900)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (294)
PWM (Da):   %s   34056.03 (31815.9)  
PI (pH):   %s   9.15 (9.50) Peptide Signal:   %s   cut: 24 range:24-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFVAALCLSSVLVFSISSGADALSLNYYEKTCPDVDSIVTNAVNHAMMKDKTVPAALLRMHFHDCFIRACDASVLLNSKGNNKAEKDGPPNMSLHAFYVIDNAKKEVEASCPGVVSCADILALAARDAVVLSGGPTWDVPKGRKDGRTSRASETTRLPSPTFNIAQLQQSFSQRGLSLDDLVALSGGHTLGFSHCSSFQSRIRNFNATHDIDPSMHPSFAASLRSICPKSNRAKNAGTTMDPSSTTFDNTYFKSILQKRGLFSSDQSLLSTPKTKDLVTKFASSKANFNKAFVSSMIKMSSITGGQEVRKDCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (3 introns) and 4 ESTs (NCBI BU880887, DT500872, CV237711, DT473819).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTGTTGCTGCTTTATGCTTGAGCTCGGTTCTCGTATTCTCGATATCTTCAGGAGCAGATGCACTGAGCTTGAATTACTATGAGAAAACATGCCCTGATGTCGATTCCATTGTT
ACGAATGCTGTCAATCATGCAATGATGAAAGACAAAACGGTCCCCGCAGCGCTACTCCGGATGCATTTCCATGACTGTTTCATAAGA
GTAGAGATTAACATTTCATATTTTTCTTCTATC
ATTTTCCTGCTCGTTGTTTGTTCCTAACTTGGATGTTTGCATCTTGTTTCAGGCCTGTGATGCTTCTGTTCTGCTAAATTCGAAAGGGAACAACAAAGCAGAGAAAGATGGCCCACCTAA
TATGTCTTTGCATGCGTTTTATGTCATTGACAACGCAAAGAAAGAAGTGGAAGCTTCATGCCCAGGAGTGGTATCATGCGCTGATATCTTGGCTTTAGCTGCAAGAGATGCAGTTGTACT
T
GTAAGATAACAAAACGAGCTAAAACATTCCCTCAAGATCAGGACTATCACTTATCTAAACAAAAAGTAAACCTGGAAACTTCAGAGATAACAATGACAAAAAAATAATAATTATGTTCC
TGATGGTTTTATCAATTTCATATTGCAGTCCGGAGGTCCAACATGGGATGTCCCAAAAGGAAGAAAAGATGGGAGAACGTCAAGGGCTAGTGAAACAACACGGTTGCCTTCTCCTACCTT
TAACATAGCTCAGCTGCAGCAGAGTTTCTCTCAGAGAGGTCTGTCCCTGGATGACCTTGTGGCTCTTTCAG
GTAAACAGAAGCCTGACTGCTACTGTTACTATTTGTTTCAATAGTTTTC
ATCTATGAAATCACGACGTTGCCAACTACTCATATGCAGGTGGCCATACTTTAGGGTTTTCCCACTGCTCATCCTTCCAAAGTAGAATCCGCAATTTCAATGCCACTCATGACATAGACC
CATCCATGCATCCATCGTTTGCAGCCAGCTTAAGGAGTATTTGTCCAAAATCGAACAGGGCAAAGAATGCAGGAACAACCATGGATCCCTCGTCGACAACTTTTGATAATACATATTTCA
AGTCGATCCTCCAGAAAAGGGGTCTATTCTCCTCAGACCAATCTCTACTCAGCACTCCAAAGACTAAAGATTTGGTCACCAAGTTTGCTAGCTCCAAAGCCAATTTCAATAAGGCTTTTG
TATCATCCATGATCAAGATGAGTAGCATCACAGGCGGTCAGGAGGTTAGGAAGGATTGTAGGGTGGTAAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTGTTGCTGCTTTATGCTTGAGCTCGGTTCTCGTATTCTCGATATCTTCAGGAGCAGATGCACTGAGCTTGAATTACTATGAGAAAACATGCCCTGATGTCGATTCCATTGTT
ACGAATGCTGTCAATCATGCAATGATGAAAGACAAAACGGTCCCCGCAGCGCTACTCCGGATGCATTTCCATGACTGTTTCATAAGA
GCCTGTGATGCTTCTGTTCTGCTAAATTCGAAA
GGGAACAACAAAGCAGAGAAAGATGGCCCACCTAATATGTCTTTGCATGCGTTTTATGTCATTGACAACGCAAAGAAAGAAGTGGAAGCTTCATGCCCAGGAGTGGTATCATGCGCTGAT
ATCTTGGCTTTAGCTGCAAGAGATGCAGTTGTACTT
TCCGGAGGTCCAACATGGGATGTCCCAAAAGGAAGAAAAGATGGGAGAACGTCAAGGGCTAGTGAAACAACACGGTTGCCTTCT
CCTACCTTTAACATAGCTCAGCTGCAGCAGAGTTTCTCTCAGAGAGGTCTGTCCCTGGATGACCTTGTGGCTCTTTCAG
GTGGCCATACTTTAGGGTTTTCCCACTGCTCATCCTTCCAA
AGTAGAATCCGCAATTTCAATGCCACTCATGACATAGACCCATCCATGCATCCATCGTTTGCAGCCAGCTTAAGGAGTATTTGTCCAAAATCGAACAGGGCAAAGAATGCAGGAACAACC
ATGGATCCCTCGTCGACAACTTTTGATAATACATATTTCAAGTCGATCCTCCAGAAAAGGGGTCTATTCTCCTCAGACCAATCTCTACTCAGCACTCCAAAGACTAAAGATTTGGTCACC
AAGTTTGCTAGCTCCAAAGCCAATTTCAATAAGGCTTTTGTATCATCCATGATCAAGATGAGTAGCATCACAGGCGGTCAGGAGGTTAGGAAGGATTGTAGGGTGGTAAACTAA

Retrieve as FASTA