Entry information : PtPrx67 (POPTR_0002s06590 / Potri.002G065300)
Entry ID 3157
Creation 2006-06-23 (Claudia Cosio)
Last sequence changes 2006-06-23 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx67 (POPTR_0002s06590 / Potri.002G065300)
Name (synonym) PtPrx67 (POPTR_0002s06590 / Potri.002G065300)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx67
start..stop
S start..stop
PtralPrx03 606 0 1..349 1..349
PtPrx56 604 0 1..354 1..354
PtrePrx04 598 0 2..349 4..351
PtPrx57 573 0 1..353 1..352
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4398917..4399165 249 N° 2 4398609..4398803 195 N° 3 4397200..4397820 621  
complement(join(4397200..4397820,4398609..4398803,4398917..4399165))


exon

Literature and cross-references PtPrx67 (POPTR_0002s06590 / Potri.002G065300)
Literature DOE joint genome institute.
DNA ref. Phytozome 11:   scaffold_2 (4399165..4397200)
EST ref. GenBank:   BU871797
Omic ref. ePlant:   Potri.002G065300
Protein sequence: PtPrx67 (POPTR_0002s06590 / Potri.002G065300)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   354 (326)
PWM (Da):   %s   38393.24 (35497.8)  
PI (pH):   %s   5.23 (5.21) Peptide Signal:   %s   cut: 29 range:29-354
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAAKSFTPVLLISSLLVASWFCATEAKSTLPVVQGLSWTFYQSSCPKVESIIRKQLEKVFKKEIGQAAGLLRLHFHDCFVQGCDGSVLLDGSASGPSEQDAPPNLTLRARAFEIIDDLRERIHKECGRVVSCSDILAIAARDSVYLSGGPDYDVPLGRRDGLNFATRSATLDNLPPPFDNADTILSSLAAKTFDPTDVVALSGGHTIGISHCSSFTDRLYPTQDPTMDKTFANNLKGICPASDSNSTTVLDIRSPNNFDNKYYVDLMNRQGLFTSDQDLYTNKKTRGIVTSFAANQSLFFEKFVVAMIKMSQLSVLTGKEGEIRASCSVRNSGSSYLESVVEEGFEALSELI*

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (introns 1 and 2) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGTGCTGCTAAGTCTTTCACCCCCGTTCTTCTGATTTCTTCTCTCCTTGTAGCTTCTTGGTTTTGTGCGACTGAAGCAAAAAGCACTCTTCCTGTAGTGCAGGGTCTGTCGTGG
ACATTCTACCAGTCTAGCTGTCCTAAAGTTGAATCCATTATAAGGAAACAGCTAGAAAAGGTGTTCAAGAAGGAGATTGGCCAAGCTGCTGGCTTGCTTCGTCTCCACTTTCATGACTGC
TTTGTTCAG
GTTACATAATATATGTCAAGATTTCCTTAAACTCATTTTAATTAGCATTCACTATTATGTTCAGTTGTAGAATTTATCTTTCATTAAATAATATCTACACATTAAAACTGC
AGGGATGTGATGGTTCAGTCTTGCTTGATGGATCAGCCAGTGGTCCAAGCGAGCAGGACGCACCTCCCAACCTTACCTTGAGAGCAAGGGCATTTGAGATCATCGACGACCTACGCGAGC
GCATACACAAGGAGTGTGGCCGTGTCGTCTCTTGCTCTGACATTCTTGCAATTGCAGCTCGCGACTCTGTTTACTTG
GTTAGCCACTCGAATCACTCTGTTATACTAGTCTTTGATACTG
GCTAGTTAGCATCCAGTATAAAATGGAACTCCTTTTACACCGTTAAATTCACGTATACTGTTCGGTAGTATTCCTGGAAACTTTTGGGCTTGGGTCCAAGATTTCAATTCCTTATCTCGG
AGTTGGGTTCAAATCGAATAACTAGCAGCTTTCTCTGATAAAATCCCATCAGTAAAATGGTTAATTAATGGTTCTTGTTCTCGCCAGACAACGCGTGAGTCAAGTCTCTATGTTTGTATC
TACATCTAATTTCTGTCCTGCAACTAAGGGCATTGGATGTGATTGACAAGGCGTCAGATAAGCTTAGCCGATGTTGTCGTTGGAGCTTTGACCATGTAGGACCGTTTTTGTATCTAAATG
CGGAAAATTGACACATCTCAGTTTTTATCCAGTTAGTTGATGAGTGATAGCGTGAGGCAAAATCTGCATTAAGTTCTCATAATCTTAGAAGTCTCTGAAAAAGTGTTACGTTTATGACTT
GTCACTTGTCATTTGTCATGAACATTAATACATATATAGATGTGTGGATATAAATATATATATATATTTATTTATTTCTAATGTGAGTCGTAATATTTTAATTCAGTTCAATTTGGCGAT
AATAACAACAGGGTTTCACAGTCAAATTTAGGCAACAGGCATTAAAAAATTGAAATGATATGCCCAATTAAGATTCCTTTCAGTCATAACTCATAACAAAAGCTAATCCTTCTTTAACTT
CTTTGGATTTTCTTCTTTATTGCAGTCTGGTGGTCCAGATTATGATGTTCCCTTGGGAAGGCGAGATGGTCTAAACTTTGCAACACGAAGTGCAACCTTAGATAACCTGCCGCCACCCTT
TGATAACGCCGATACAATTCTCTCATCTCTCGCCGCCAAAACCTTTGACCCCACAGACGTGGTAGCCCTGTCCGGCGGCCACACCATTGGTATAAGTCATTGCAGCTCTTTCACTGACCG
CCTCTATCCAACCCAAGATCCTACCATGGACAAAACCTTTGCCAACAATCTCAAAGGTATTTGCCCCGCGAGTGACTCCAATAGCACTACCGTGTTGGATATTCGGTCCCCTAATAATTT
TGATAACAAGTACTATGTCGATCTCATGAACCGCCAAGGCCTGTTTACCTCGGACCAAGACTTGTACACGAACAAGAAGACAAGGGGCATTGTCACTAGCTTTGCTGCTAATCAAAGTTT
GTTCTTTGAGAAGTTTGTGGTTGCAATGATCAAAATGTCACAGCTAAGCGTATTGACCGGAAAAGAAGGTGAAATTCGCGCAAGTTGCTCGGTGAGAAACTCAGGCTCCAGCTACTTGGA
GTCTGTGGTGGAAGAGGGTTTCGAGGCACTGTCAGAACTAATATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGTGCTGCTAAGTCTTTCACCCCCGTTCTTCTGATTTCTTCTCTCCTTGTAGCTTCTTGGTTTTGTGCGACTGAAGCAAAAAGCACTCTTCCTGTAGTGCAGGGTCTGTCGTGG
ACATTCTACCAGTCTAGCTGTCCTAAAGTTGAATCCATTATAAGGAAACAGCTAGAAAAGGTGTTCAAGAAGGAGATTGGCCAAGCTGCTGGCTTGCTTCGTCTCCACTTTCATGACTGC
TTTGTTCAG
GGATGTGATGGTTCAGTCTTGCTTGATGGATCAGCCAGTGGTCCAAGCGAGCAGGACGCACCTCCCAACCTTACCTTGAGAGCAAGGGCATTTGAGATCATCGACGACCTA
CGCGAGCGCATACACAAGGAGTGTGGCCGTGTCGTCTCTTGCTCTGACATTCTTGCAATTGCAGCTCGCGACTCTGTTTACTTG
TCTGGTGGTCCAGATTATGATGTTCCCTTGGGAAGG
CGAGATGGTCTAAACTTTGCAACACGAAGTGCAACCTTAGATAACCTGCCGCCACCCTTTGATAACGCCGATACAATTCTCTCATCTCTCGCCGCCAAAACCTTTGACCCCACAGACGTG
GTAGCCCTGTCCGGCGGCCACACCATTGGTATAAGTCATTGCAGCTCTTTCACTGACCGCCTCTATCCAACCCAAGATCCTACCATGGACAAAACCTTTGCCAACAATCTCAAAGGTATT
TGCCCCGCGAGTGACTCCAATAGCACTACCGTGTTGGATATTCGGTCCCCTAATAATTTTGATAACAAGTACTATGTCGATCTCATGAACCGCCAAGGCCTGTTTACCTCGGACCAAGAC
TTGTACACGAACAAGAAGACAAGGGGCATTGTCACTAGCTTTGCTGCTAATCAAAGTTTGTTCTTTGAGAAGTTTGTGGTTGCAATGATCAAAATGTCACAGCTAAGCGTATTGACCGGA
AAAGAAGGTGAAATTCGCGCAAGTTGCTCGGTGAGAAACTCAGGCTCCAGCTACTTGGAGTCTGTGGTGGAAGAGGGTTTCGAGGCACTGTCAGAACTAATATAA

Retrieve as FASTA