Entry information : PtPrx77 (POPTR_0007s02560 / Potri.007G122300)
Entry ID 3172
Creation 2006-07-21 (Claudia Cosio)
Last sequence changes 2010-06-29 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-05 (Qiang Li)
Peroxidase information: PtPrx77 (POPTR_0007s02560 / Potri.007G122300)
Name (synonym) PtPrx77 (POPTR_0007s02560 / Potri.007G122300)
Class Class III peroxidase    [Orthogroup: Prx044]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx77
start..stop
S start..stop
PtPrx28 661 0 1..327 1..327
PtPrx29 637 0 1..327 1..327
RcPrx10 531 0 1..327 1..327
MePrx106 521 0 1..327 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1508241..1508462 222 N° 2 1508596..1508784 189 N° 3 1508865..1509030 166 N° 4 1509107..1509513 407
join(1508241..1508462,1508596..1508784,1508865..1509030,1509107..1509513)


exon

Literature and cross-references PtPrx77 (POPTR_0007s02560 / Potri.007G122300)
DNA ref. Phytozome 11:   scaffold_7 (1508241..1509513)
Omic ref. ePlant:   Potri.007G122300
Protein sequence: PtPrx77 (POPTR_0007s02560 / Potri.007G122300)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (301)
PWM (Da):   %s   35379.17 (32595.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.38 (8.20) Peptide Signal:   %s   cut: 27 range:27-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVQKLFPVLFLQLALAFLLAGLTNAGGLQLGFYQGACPDAELIVHQTLYRYISRDPTLAAPLLRMHFHDCFIRGCEGSVLLSSTKNNQAEKDAIPNKTLRGFNVIDAVKSALEKKCPGVVSCADILALVARDAVLMIGGPRWDVPTGRRDGRVSIANEALFNLPSPFANITVLKQQFAATGLSVKDLAVLSGGHTIGIGHCTIISNRLYNFTGKGDTDPSLDPRYAAQLKNKCKPGNSNTVVEMDPGSFKSFDEDYYNIVAKRRGLFRSDAALLDDAETRGYVKFQSMTQGSTFAQDFAESMVKMGYIGVLTGEQGEIRKHCAVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns). 1 EST from P.trichocarpa x deltoides. Also found in scaffold_1693 (1716..3021, POPTR_1693s00200).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTTCAAAAGCTTTTCCCAGTCCTCTTTCTTCAACTAGCCCTTGCTTTTTTGCTTGCAGGCCTCACTAATGCAGGGGGTTTGCAACTCGGGTTCTACCAGGGAGCATGTCCTGAT
GCAGAGCTTATAGTCCATCAAACTCTTTACCGTTACATTTCTAGGGACCCAACCCTTGCTGCTCCTTTGCTGAGAATGCATTTCCATGATTGTTTCATCAGG
GTAAGCCCTTAAGCTACA
CTACTGTGCAATTTACACAGTTCTGAAACAGAATTTATCTTGTATCATTATTTTCAACATTACGTTGCTGCATAAGCACACACAGAACAATATCCTAACAAGTTATTCTTTCCAGGGATG
TGAGGGTTCTGTGCTCCTAAGTTCTACAAAGAATAATCAAGCTGAGAAAGACGCCATCCCAAATAAAACCTTAAGAGGGTTCAATGTCATTGATGCTGTAAAATCAGCACTAGAAAAGAA
GTGTCCTGGTGTGGTTTCCTGTGCCGATATCTTGGCCTTGGTTGCTCGTGACGCGGTTCTAATG
GTATCAAATTTACCAACACAATTTATCACCACTGATTAACTGGATCATTATGCCGA
TGCTTAACCAGTTTTTCCATTCAGATTGGCGGACCACGTTGGGATGTTCCCACAGGACGCAGAGACGGAAGGGTGTCGATTGCCAACGAGGCTTTATTCAATTTACCATCTCCTTTTGCC
AACATAACTGTCCTGAAACAACAATTTGCTGCAACGGGTTTAAGTGTAAAGGACCTTGCAGTTTTATCAG
GTAGTTTTCGTAACAAAAAAAGCTATCTATTAAGCAAAATATCAGCGTAT
TTACTTGGAATATGTTTTGGTGACAGGAGGACACACCATAGGAATTGGACACTGTACCATAATCTCGAACAGGTTGTACAATTTCACAGGCAAGGGAGATACTGACCCTTCATTGGACCC
AAGATACGCTGCTCAACTGAAGAATAAATGTAAGCCTGGAAACTCCAACACAGTCGTTGAGATGGACCCTGGTAGCTTCAAGTCTTTCGACGAAGATTACTACAACATTGTAGCTAAAAG
AAGAGGGCTATTCCGATCTGATGCAGCTCTTCTTGACGATGCTGAAACAAGAGGCTATGTCAAATTTCAGTCAATGACACAGGGATCCACTTTTGCACAAGATTTTGCTGAATCCATGGT
GAAAATGGGTTACATTGGAGTCCTGACCGGCGAACAAGGCGAAATCAGGAAACATTGTGCTGTTGTGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTTCAAAAGCTTTTCCCAGTCCTCTTTCTTCAACTAGCCCTTGCTTTTTTGCTTGCAGGCCTCACTAATGCAGGGGGTTTGCAACTCGGGTTCTACCAGGGAGCATGTCCTGAT
GCAGAGCTTATAGTCCATCAAACTCTTTACCGTTACATTTCTAGGGACCCAACCCTTGCTGCTCCTTTGCTGAGAATGCATTTCCATGATTGTTTCATCAGG
GGATGTGAGGGTTCTGTG
CTCCTAAGTTCTACAAAGAATAATCAAGCTGAGAAAGACGCCATCCCAAATAAAACCTTAAGAGGGTTCAATGTCATTGATGCTGTAAAATCAGCACTAGAAAAGAAGTGTCCTGGTGTG
GTTTCCTGTGCCGATATCTTGGCCTTGGTTGCTCGTGACGCGGTTCTAATG
ATTGGCGGACCACGTTGGGATGTTCCCACAGGACGCAGAGACGGAAGGGTGTCGATTGCCAACGAGGCT
TTATTCAATTTACCATCTCCTTTTGCCAACATAACTGTCCTGAAACAACAATTTGCTGCAACGGGTTTAAGTGTAAAGGACCTTGCAGTTTTATCAG
GAGGACACACCATAGGAATTGGA
CACTGTACCATAATCTCGAACAGGTTGTACAATTTCACAGGCAAGGGAGATACTGACCCTTCATTGGACCCAAGATACGCTGCTCAACTGAAGAATAAATGTAAGCCTGGAAACTCCAAC
ACAGTCGTTGAGATGGACCCTGGTAGCTTCAAGTCTTTCGACGAAGATTACTACAACATTGTAGCTAAAAGAAGAGGGCTATTCCGATCTGATGCAGCTCTTCTTGACGATGCTGAAACA
AGAGGCTATGTCAAATTTCAGTCAATGACACAGGGATCCACTTTTGCACAAGATTTTGCTGAATCCATGGTGAAAATGGGTTACATTGGAGTCCTGACCGGCGAACAAGGCGAAATCAGG
AAACATTGTGCTGTTGTGAATTAA

Retrieve as FASTA