Entry information : PtPrx78(POPTR_0006s06890 / Potri.006G069600)
Entry ID 3173
Creation 2006-06-07 (Claudia Cosio)
Last sequence changes 2006-06-07 (Catherine )
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-05-15 (Catherine )
Peroxidase information: PtPrx78(POPTR_0006s06890 / Potri.006G069600)
Name PtPrx78(POPTR_0006s06890 / Potri.006G069600)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx78
start..stop
S start..stop
PtPrx50 589 0 1..321 1..323
RcPrx09 572 0 1..321 1..321
PpePrx26 555 0 1..321 1..321
CclPrx45 548 0 1..321 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5217015..5217215 201 N° 2 5217313..5217492 180 N° 3 5217599..5217761 163 N° 4 5218030..5218451 422
join(5217015..5217215,5217313..5217492,5217599..5217761,5218030..5218451)


exon

Literature and cross-references PtPrx78(POPTR_0006s06890 / Potri.006G069600)
Literature DOE joint genome institute.
DNA ref. Phytozome 12:   Chr6 (5217015..5218451)
Cluster/Prediction ref. JGI gene:   560610
Omic ref. ePlant:   Potri.006G069600
Protein sequence: PtPrx78(POPTR_0006s06890 / Potri.006G069600)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (301)
PWM (Da):   %s   34803.64 (32588.4)  
PI (pH):   %s   6.36 (6.66) Peptide Signal:   %s   cut: 21 range:21-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEGLWLVVLVIFVMALSVQSQLKTGFYSTSCSKAEAIVRSTVESYFKKDPTIAAGLLRLHFHDCFVQGCDGSVLIAGSSAERNALPNLGLRGFEVIDDAKSQIEALCPGVVSCADILALAARDAVDLSDGPSWSVPTGRRDGRVSLSSQASNLPSPLDTVAAQKQKFSDKGLDDHDLVTLVGAHTIGQTHCQFIRYRLYNFTTTGNSDPTINQSFLSQLQALCPKNGDGTKPVPLDKDSQTDFDTSFFKNVRDGNGVLESDQRLWDDAATRDVVKKYAGTIRGLLGLRFDIEFRQAMVKMSSIEVKTGTDGEIRKVCSKFN

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGGATTATGGCTGGTTGTTTTGGTGATTTTTGTAATGGCTTTGTCTGTGCAAAGCCAATTGAAAACAGGGTTTTATTCTACTTCATGTTCGAAAGCTGAGGCCATTGTTAGGTCC
ACTGTTGAATCTTACTTCAAAAAAGATCCCACCATTGCAGCTGGATTGCTCAGGCTTCATTTTCATGACTGCTTTGTCCAG
GTATATATATATATATATATATTCTCCACCTCCTTTAGC
ATGTTTGTATAATTGTCAATAATCTACACGGACTAAGAACATTAATGTTCTTTTACAGGGCTGCGATGGTTCAGTATTGATTGCGGGGTCTTCTGCCGAGAGAAATGCCTTGCCGAATCT
TGGATTAAGAGGTTTTGAAGTAATTGATGATGCTAAATCACAGATTGAGGCCTTATGCCCTGGGGTGGTCTCATGTGCTGACATACTAGCTTTGGCTGCTCGTGATGCTGTGGACTTG
GT
AATTCAGATCCCTTCACCCTCAATTTCCAATACTTGAATGAAAGAGTTACATGAATTTGTATGCATGGTTTCCTTAAGGGTTGTGCTTATTGCAATATTTTCAGAGTGATGGTCCAAGTT
GGTCAGTCCCAACAGGTAGAAGAGATGGCAGGGTCTCTTTATCATCCCAGGCCTCAAATTTACCTTCACCTCTAGACACCGTAGCTGCCCAGAAGCAAAAATTTTCTGATAAAGGCCTGG
ACGATCACGATCTCGTAACCCTCGTCG
GTATAAATAATCTTTTCTTTCCCATTCTAAGTTAATTCGCAGTACTAAGAGGTTGAGACTAAGCCAATCTCTTCGATCTGGTTCAAGACTTGC
TACATATTCATGCCGAGGCCAGAGAACTCATGAAAGTCTTAGTTCTTGTAACCAAGTATGAGATTTAAAGAAAAAACGTATCTTCTTAACCATCAGGCTGGACTTCGGTTTCAAGAAATA
ATTTTACTGCCGCATGTTTTGTAGCATATTGTTATGGTGCTTGTTTATGTTTCAGGGGCACATACCATTGGCCAAACACACTGTCAATTCATTCGATATCGCCTATACAACTTCACAACA
ACAGGCAACTCAGACCCGACAATAAACCAATCATTCCTATCACAACTTCAAGCTCTATGTCCCAAAAATGGCGATGGCACAAAACCAGTTCCATTAGACAAAGATAGCCAGACAGATTTT
GATACAAGCTTCTTCAAGAACGTACGTGATGGCAATGGAGTTTTGGAGTCGGACCAGAGACTTTGGGATGACGCTGCAACACGTGATGTTGTGAAAAAATATGCTGGCACCATAAGAGGA
TTACTGGGACTTAGGTTTGATATTGAGTTTAGGCAAGCTATGGTTAAAATGAGTAGCATTGAAGTGAAAACTGGGACTGATGGAGAGATAAGAAAAGTCTGTTCAAAGTTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGGATTATGGCTGGTTGTTTTGGTGATTTTTGTAATGGCTTTGTCTGTGCAAAGCCAATTGAAAACAGGGTTTTATTCTACTTCATGTTCGAAAGCTGAGGCCATTGTTAGGTCC
ACTGTTGAATCTTACTTCAAAAAAGATCCCACCATTGCAGCTGGATTGCTCAGGCTTCATTTTCATGACTGCTTTGTCCAG
GGCTGCGATGGTTCAGTATTGATTGCGGGGTCTTCTGCC
GAGAGAAATGCCTTGCCGAATCTTGGATTAAGAGGTTTTGAAGTAATTGATGATGCTAAATCACAGATTGAGGCCTTATGCCCTGGGGTGGTCTCATGTGCTGACATACTAGCTTTGGCT
GCTCGTGATGCTGTGGACTTG
AGTGATGGTCCAAGTTGGTCAGTCCCAACAGGTAGAAGAGATGGCAGGGTCTCTTTATCATCCCAGGCCTCAAATTTACCTTCACCTCTAGACACCGTA
GCTGCCCAGAAGCAAAAATTTTCTGATAAAGGCCTGGACGATCACGATCTCGTAACCCTCGTCG
GGGCACATACCATTGGCCAAACACACTGTCAATTCATTCGATATCGCCTATACAAC
TTCACAACAACAGGCAACTCAGACCCGACAATAAACCAATCATTCCTATCACAACTTCAAGCTCTATGTCCCAAAAATGGCGATGGCACAAAACCAGTTCCATTAGACAAAGATAGCCAG
ACAGATTTTGATACAAGCTTCTTCAAGAACGTACGTGATGGCAATGGAGTTTTGGAGTCGGACCAGAGACTTTGGGATGACGCTGCAACACGTGATGTTGTGAAAAAATATGCTGGCACC
ATAAGAGGATTACTGGGACTTAGGTTTGATATTGAGTTTAGGCAAGCTATGGTTAAAATGAGTAGCATTGAAGTGAAAACTGGGACTGATGGAGAGATAAGAAAAGTCTGTTCAAAGTTC
AATTAA

Retrieve as FASTA