Entry information : PtPrx83 (POPTR_0001s02870 / Potri.001G145800)
Entry ID 3200
Creation 2010-04-13 (Christophe Dunand)
Last sequence changes 2010-06-17 (Marie Brette (Scipio))
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx83 (POPTR_0001s02870 / Potri.001G145800)
Name (synonym) PtPrx83 (POPTR_0001s02870 / Potri.001G145800)
Class Class III peroxidase    [Orthogroup: Prx046]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx83
start..stop
S start..stop
PpePrx23 529 0 13..338 4..333
VvPrx15 517 0 10..337 3..331
GmPrx105 504 0 12..338 4..332
MtPrx90 501 3e-180 24..337 16..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11868035..11868271 237 N° 2 11867603..11867794 192 N° 3 11867200..11867365 166 N° 4 11866647..11867068 422
complement(join(11866647..11867068,11867200..11867365,11867603..11867794,1186803 5..11868271))


exon

Literature and cross-references PtPrx83 (POPTR_0001s02870 / Potri.001G145800)
DNA ref. Phytozome 12:   Chr01 (11868271..11866647)
Omic ref. ePlant:   Potri.001G145800
Protein sequence: PtPrx83 (POPTR_0001s02870 / Potri.001G145800)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (309)
PWM (Da):   %s   37941.05 (34693.4)  
PI (pH):   %s   6.51 (6.51) Peptide Signal:   %s   cut: 30 range:30-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSCDFSRNPFTMVFITLLVLVLQSLSTFGDEQLLVRDYYKETCPMVEEIVRYNLQFAVLKNPRMAASLLRLHFHDCFVMGCDASVLLDSYGGMVSEKQAGPNVNSLRGFEVIDRIKYQLEEACPLIVSCADILAIAARDAVAVRGGPGWEVYLGRKDSLKASFDGANQFIPAPNSSLETLIANFKQHGLDIGDLVALSGSHTMGKARCLSFRQQIHDESAEEHYDKYKRYTPFRRILRSICPKTGKDNQLAPLDFETPARFDNHYFLNILEGRGLLGSDNVLVTEDHEGEIRKQVWAYASDQKLFFASFANSMIKMGNINVLYGNEGEVRKNCRFVNT

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCATGTGATTTCTCAAGGAATCCCTTTACAATGGTCTTTATCACTTTACTGGTTTTGGTCTTGCAAAGCTTGTCGACCTTTGGTGATGAACAACTTTTAGTCCGTGACTATTACAAG
GAAACATGCCCTATGGTTGAAGAGATTGTTAGGTATAATCTTCAGTTTGCCGTGCTTAAAAATCCAAGAATGGCCGCCTCTCTGCTTCGCTTGCATTTTCATGATTGCTTCGTTATG
GTC
AGGCCTCTCGTTTTCTCTAATTCTGTGTCTGTGTTTCCTCGTAATGAATATTGCACCCCCTTTTCTTGCTGTTTTTCTTTTCGGAAAAATAAATAAATAAAGAATTGCTAGAGAACTGAA
TACTACTTGCTAACAGATAATTCTCATTAATTTTGTAGCATCATCATTCTTTCTATCACAAATTCACAATTCCAAGTCTTAAATTCACCAATCCTGATTGGTTCTGGTATTAATCAGGGA
TGCGATGCATCGGTTCTTCTAGACAGCTATGGAGGCATGGTCAGTGAAAAGCAGGCAGGGCCTAACGTGAACTCATTGCGTGGATTCGAAGTCATTGATAGGATCAAGTATCAATTGGAA
GAAGCATGCCCTCTCATAGTCTCATGTGCTGATATCTTAGCCATTGCTGCTCGTGATGCTGTTGCAGTG
GTAAATGTGCATATATATATATATATATATATATATATATATATATATATA
TACACCTCTCTCTTTCTGCCTCTCATCTCACTACTGTCTCATTATATATAAGCTCCATTACAAGGTGGCTTCAATAACATAAATGTTAAGAAAGCTGGTAATGTCGTATGTCAAATGATT
AATTCCTTGATGACATTTGGGATCAAGTAATACATGTAGTTTCTAATTTTCCTTTTACTTTGGAAGAGAGGTGGCCCAGGTTGGGAGGTTTATCTAGGCAGAAAGGACTCCCTCAAGGCA
AGTTTTGATGGTGCCAATCAGTTTATACCCGCACCAAATTCCTCTCTGGAGACTCTCATTGCCAATTTTAAACAACATGGTCTTGACATAGGAGACTTGGTTGCTTTATCAG
GTTAAATC
CACAACATTATCTCATGTAAATAATTACTTATTTATTTATAAATCTTTTAAAAAACACCACTAAACACATAGGTTGTAATGACATATAGTGCTTGCCCATATATAAGCGTCTTGGTTTCA
CAGGTAGCCACACGATGGGAAAGGCAAGATGCTTAAGCTTTAGGCAACAAATACACGATGAGAGTGCTGAAGAACATTACGATAAATACAAGAGATACACCCCCTTTCGAAGAATCCTAC
GGTCCATATGTCCAAAAACAGGAAAAGACAATCAATTGGCTCCGCTTGATTTTGAAACCCCGGCTAGATTTGACAACCACTATTTCCTCAACATTCTTGAGGGAAGAGGGTTGCTGGGGT
CCGATAACGTGTTGGTGACGGAAGATCATGAGGGGGAGATAAGAAAGCAGGTGTGGGCTTATGCCTCTGATCAAAAGCTTTTCTTCGCATCGTTTGCCAATTCTATGATAAAGATGGGGA
ATATTAACGTACTTTATGGGAATGAAGGAGAGGTCAGGAAGAATTGTAGGTTTGTCAACACCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCATGTGATTTCTCAAGGAATCCCTTTACAATGGTCTTTATCACTTTACTGGTTTTGGTCTTGCAAAGCTTGTCGACCTTTGGTGATGAACAACTTTTAGTCCGTGACTATTACAAG
GAAACATGCCCTATGGTTGAAGAGATTGTTAGGTATAATCTTCAGTTTGCCGTGCTTAAAAATCCAAGAATGGCCGCCTCTCTGCTTCGCTTGCATTTTCATGATTGCTTCGTTATG
GGA
TGCGATGCATCGGTTCTTCTAGACAGCTATGGAGGCATGGTCAGTGAAAAGCAGGCAGGGCCTAACGTGAACTCATTGCGTGGATTCGAAGTCATTGATAGGATCAAGTATCAATTGGAA
GAAGCATGCCCTCTCATAGTCTCATGTGCTGATATCTTAGCCATTGCTGCTCGTGATGCTGTTGCAGTG
AGAGGTGGCCCAGGTTGGGAGGTTTATCTAGGCAGAAAGGACTCCCTCAAG
GCAAGTTTTGATGGTGCCAATCAGTTTATACCCGCACCAAATTCCTCTCTGGAGACTCTCATTGCCAATTTTAAACAACATGGTCTTGACATAGGAGACTTGGTTGCTTTATCAG
GTAGC
CACACGATGGGAAAGGCAAGATGCTTAAGCTTTAGGCAACAAATACACGATGAGAGTGCTGAAGAACATTACGATAAATACAAGAGATACACCCCCTTTCGAAGAATCCTACGGTCCATA
TGTCCAAAAACAGGAAAAGACAATCAATTGGCTCCGCTTGATTTTGAAACCCCGGCTAGATTTGACAACCACTATTTCCTCAACATTCTTGAGGGAAGAGGGTTGCTGGGGTCCGATAAC
GTGTTGGTGACGGAAGATCATGAGGGGGAGATAAGAAAGCAGGTGTGGGCTTATGCCTCTGATCAAAAGCTTTTCTTCGCATCGTTTGCCAATTCTATGATAAAGATGGGGAATATTAAC
GTACTTTATGGGAATGAAGGAGAGGTCAGGAAGAATTGTAGGTTTGTCAACACCTAA

Retrieve as FASTA